Protein detail
PTC1
Protein patched homolog 1 (PTC) (PTC1)
Entry name PTC1 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 12 | Protein classification Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Protein patched homolog 1 (PTC) (PTC1)
Protein Class (7)
Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (9)
- Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
- Predicted intracellular proteins
- Human disease related genes:Cancers:Skin cancers
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Transmembrane
101..121; Helical; 437..457; Helical; 473..493; Helical; 502..522; Helical; 548..568; Helical; 578..598; Helical; 749..769; Helical; 1028..1048; Helical; 1056..1076; Helical; 1084..1104; Helical; 1122..1141; Helical; 1155..1175; Helical
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
BCNSNBCCSPTCH
Gene Description
Patched 1
Chromosome
9
Position
95442980-95517057
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization1
Cell SpecificAstrocytes
Function & Pathway7
Protein Function (9)
- Human disease related genes:Cancers:Cancers of eye, brain, and central nervous system
- Predicted intracellular proteins
- Human disease related genes:Cancers:Skin cancers
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Cellular Component (12)
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0005901 caveola
- GO:0030496 midbody
- GO:0030666 endocytic vesicle membrane
- GO:0043231 intracellular membrane-bounded organelle
- GO:0044294 dendritic growth cone
- GO:0044295 axonal growth cone
- GO:0045177 apical part of cell
- GO:0045211 postsynaptic membrane
Page 1 of 2
Molecular Function (9)
Biological Process (3)
KEGG (6)
Reactome (9)
- R-hsa-5635838 activation of smo
- R-hsa-373080 class b 2 secretin family receptors
- R-hsa-5635851 gli proteins bind promoters of hh responsive genes to promote transcription
- R-hsa-500792 gpcr ligand binding
- R-hsa-5610787 hedgehog off state
- R-hsa-5632684 hedgehog on state
- R-hsa-5632681 ligand receptor interactions
- R-hsa-372790 signaling by gpcr
- R-hsa-5358351 signaling by hedgehog
Mediation Categories (3)
Fusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence67
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PTCH1 | CASP3 | P42574 | D | 1,405 | cleavage | SIGNOR | SIGNOR:12907805SIGNOR:23074268 |
Ligand-Receptor Signaling (46)
46 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | Kirouac2010 | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| receptor | receptor | Baccin2019 | No | Yes | No | Yes | No |
| receptor | receptor | SignaLink_function | No | Yes | No | Yes | No |
| patched | receptor | Almen2009 | No | Yes | No | Yes | No |
Page 1 of 5Next
Regulatory Interaction Network (10)
10 records.
Protein Complex Composition (9)
9 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CDC2-CCNB1-PTCH1 complex | CCNB1CDK1PTCH1 | P06493P14635Q13635 | 1:1:1 | CompleatCORUM | Compleat:HC2850CORUM:5551 | 11331587 |
| PTCH_GAS1_transmembrane_receptor | GAS1PTCH1 | P54826Q13635 | 1:1 | CellPhoneDB | CellPhoneDB:PTCH_GAS1_transmembrane_receptor | |
| DHHPTCH1 | O43323Q13635 | 0:0 | KEGG-MEDICUS | |||
| PTCH1 | Q13635 | 3 | PDB | PDB:6rvc | ||
| IHHPTCH1 | Q13635Q14623 | 0:0 | KEGG-MEDICUS | |||
| ABCA2PON2PTCH1ST3GAL6ST6GALNAC3 | Q13635Q15165Q8NDV1Q9BZC7Q9Y274 | 0:0:0:0:0 | hu.MAP | |||
| PTCH1SHH | Q13635Q15465 | 2:1 | KEGG-MEDICUSPDB | PDB:6n7kPDB:6dmyPDB:6n7gPDB:6e1hPDB:6n7hPDB:6oevPDB:6rvd | ||
| PTCH1UGT3A2 | Q13635Q3SY77 | 0:0 | hu.MAP | |||
| BPNT2GUCD1PTCH1 | Q13635Q96NT3Q9NX62 | 0:0:0 | hu.MAP2 |
Sequence, Structure & Domains14
Sequences
Length
1,447
Mass
160,545
Sequence
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEERPRGSSSN
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=L; Synonyms=1B; IsoId=Q13635-1; Sequence=Displayed; Name=L'; Synonyms=1Ckid; IsoId=Q13635-2; Sequence=VSP_041369; Name=M; Synonyms=1C; IsoId=Q13635-3; Sequence=VSP_041371; Name=S; Synonyms=1A, 1CdeltaE2; IsoId=Q13635-4; Sequence=VSP_041370
Alternative Sequence
1..66; MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAFALEQIS -> MELLNRNRLVIVSPRCTPPKASGGPARRGFYTFRSFCKDGGGGEEEEENGGEEKDDRGDKETRSD (in isoform L'); 2..152; Missing (in isoform S); 2..67; Missing (in isoform M)
3D Structural Models
Turn
53..55; 256..258; 270..272; 288..293; 309..312; 332..334; 462..464; 500..502; 532..534; 777..780; 957..959; 1103..1106; 1149..1152
Helix
48..51; 58..67; 78..96; 99..113; 114..118; 125..128; 135..146; 172..186; 199..202; 214..223; 231..234; 236..241; 261..269; 276..285; 319..323; 339..342; 350..352; 369..376; 380..382; 389..409; 426..434; 439..457; 467..490; 503..511; 512..514; 515..523; 536..543; 546..553; 556..561; 568..573; 576..590; 592..604; 732..738; 741..744; 747..769; 788..796; 812..814; 816..825; 826..828; 844..864; 878..887; 899..903; 910..912; 919..929; 931..934; 984..1004; 1013..1016; 1017..1019; 1020..1022; 1024..1047; 1051..1074; 1081..1102; 1111..1120; 1124..1137; 1138..1140; 1153..1167; 1170..1177
Beta Strand
74..77; 132..134; 148..150; 155..164; 189..192; 195..198; 205..210; 249..253; 299..301; 336..338; 343..345; 347..349; 354..356; 358..366; 383..385; 413..415; 416..422; 497..499; 526..528; 783..785; 801..809; 829..832; 836..838; 869..871; 873..876; 893..895; 916..918; 972..978; 1007..1012; 1108..1110; 1142..1145; 1146..1148
3D Structure
Electron microscopy (12); X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
13..30; Gly residues; 1217..1232; Low complexity; 1349..1358; Polar residues
Domain (FT)
438..598; SSD
Region
1..43; Disordered; 1189..1234; Disordered; 1270..1360; Disordered
Protein Families
Patched family
Sequence Similarities
Belongs to the patched family.
Clinical Relevance6
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 39341061 | Four-dimensional trapped ion mobility spectrometry proteomics reveals circulating extracellular vesicles encapsulated drivers of nasopharyngeal carcinoma distant dissemination. | Emerging evidence shows that extracellular vesicles (EVs) are key players in cancer metastasis, but their role in NPC metastasis remains poorly understood. |