Protein detail
OPCM
Opioid-binding protein/cell adhesion molecule (OBCAM) (OPCML) (Opioid-binding cell adhesion molecule) (IgLON family member 1)
Protein symbol OPCM | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count | Protein classification |
Basic Information
Protein Names
Opioid-binding protein/cell adhesion molecule (OBCAM) (OPCML) (Opioid-binding cell adhesion molecule) (IgLON family member 1)
Protein Function
- Human disease related genes:Cancers:Cancers of the breast and female genital organs
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Tissue SpecificintestineCell SpecificEnterocytesBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
- Human disease related genes:Cancers:Cancers of the breast and female genital organs
- Disease related genes
- Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
Reactome
Mediation Categories
Metabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
23 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | Yes |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | Yes |
| transmembrane | transmembrane | LOCATE | No | No | No | No | Yes |
| transmembrane | transmembrane | OmniPath | No | No | No | No | Yes |
| peripheral | peripheral | UniProt_location | No | No | No | No | Yes |
| peripheral | peripheral | OmniPath | No | No | No | No | Yes |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | Yes |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | No | Yes |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | No | No | No | No | Yes |
Regulatory Interaction Network
0 records.
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
345
Mass
38,008
Sequence
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q14982-1; Sequence=Displayed; Name=2; IsoId=Q14982-2; Sequence=VSP_043440; Name=3; IsoId=Q14982-3; Sequence=VSP_047730; Name=4; IsoId=Q14982-4; Sequence=VSP_054155
Alternative Sequence
1..41; Missing (in isoform 3); 1..27; MGVCGYLFLPWKCLVVVSLRLLFLVPT -> MYHPAYWVVFSATTALLFIP (in isoform 2); 312; Y -> YEISPSSAVA (in isoform 4)
3D Structural Models
Turn
288..290
Helix
107..109; 194..196
Beta Strand
44..48; 53..58; 63..70; 73..77; 88..94; 97..102; 111..121; 127..141; 145..148; 153..163; 166..171; 180..191; 198..205; 207..209; 212..228; 240..250; 253..258; 270..274; 276..285; 292..300; 303..312
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
39..126; Ig-like C2-type 1; 136..219; Ig-like C2-type 2; 223..310; Ig-like C2-type 3
Protein Families
- Immunoglobulin superfamily
- IgLON family
Sequence Similarities
Belongs to the immunoglobulin superfamily. IgLON family.