Protein detail
AAAT
Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)
Entry name AAAT | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 25 | Transmembrane count 8 | Protein classification FDA approved drug targetsMetabolic proteinsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium-dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)
Protein Class (6)
FDA approved drug targetsMetabolic proteinsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Transporters:Electrochemical Potential-driven transporters
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Transmembrane
52..81; Helical; Name=1; 95..116; Helical; Name=2; 131..153; Helical; Name=3; 225..248; Helical; Name=4; 258..285; Helical; Name=5; 307..328; Helical; Name=6; 374..400; Helical; Name=7; 461..482; Helical; Name=8
Transmembrane Count
8
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
AAATASCT2M7V1RDRC
Gene Description
Solute carrier family 1 member 5
Chromosome
19
Position
46774883-46788594
Supporting publications (n)
25
EVMP confidence score
0.75
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificInnate lymphoid cellsSingle-Nuclei Brain SpecificleukocyteBlood Cell SpecificgdT-cellBlood Lineage SpecificNK-cells
Function & Pathway
Protein Function (3)
- Transporters:Electrochemical Potential-driven transporters
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (12)
- GO:0001618 virus receptor activity
- GO:0005515 protein binding
- GO:0015171 amino acid transmembrane transporter activity
- GO:0015175 neutral L-amino acid transmembrane transporter activity
- GO:0015183 L-aspartate transmembrane transporter activity
- GO:0015186 L-glutamine transmembrane transporter activity
- GO:0015194 L-serine transmembrane transporter activity
- GO:0015293 symporter activity
- GO:0015297 antiporter activity
- GO:0022834 ligand-gated channel activity
Page 1 of 2
Biological Process (3)
Reactome (10)
- R-hsa-9013149 rac1 gtpase cycle
- R-hsa-9013423 rac3 gtpase cycle
- R-hsa-9013407 rhoh gtpase cycle
- R-hsa-9013409 rhoj gtpase cycle
- R-hsa-9013406 rhoq gtpase cycle
- R-hsa-9012999 rho gtpase cycle
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-9958863 slc mediated transport of amino acids
- R-hsa-382551 transport of small molecules
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence28
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | CellPhoneDB | |||||
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | LOCATE | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| peripheral | peripheral | UniProt_topology | |||||
| peripheral | peripheral | OmniPath |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryWestern blotting | 1 | 37886648 |
Sequence, Structure & Domains
Sequences
Length
541
Mass
56,598
Sequence
MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
Alternative Products
Event=Alternative splicing, Alternative initiation; Named isoforms=3; Comment=A number of isoforms are produced by alternative initiation. Isoforms start at multiple alternative CUG and GUG codons.; Name=1; IsoId=Q15758-1; Sequence=Displayed; Name=2; IsoId=Q15758-2; Sequence=VSP_046354; Name=3; IsoId=Q15758-3; Sequence=VSP_046851
Alternative Sequence
1..228; Missing (in isoform 3); 1..203; MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRS -> M (in isoform 2)
3D Structural Models
Turn
169..173; 354..356; 432..435; 457..459
Helix
44..51; 53..74; 77..117; 121..153; 160..162; 165..168; 180..191; 196..199; 231..248; 249..252; 253..291; 295..318; 320..329; 333..339; 341..350; 357..368; 372..385; 388..404; 411..427; 436..445; 450..452; 453..456; 460..488
Beta Strand
157..159; 202..209; 214..216; 220..228
3D Structure
Electron microscopy (19); X-ray crystallography (4)
Domain & Motif Annotations
Domain (CC)
The transport domain consists of four transmembrane regions 3, 6, 7 and 8 and two helical hairpins HP1 and HP2. According to the one-gate elevator transport model, substrate binding and release is controlled by HP2 which acts as a gate for the transport domain. HP2 gate opening enables substrate binding or release. The gate closes once one amino acid and up to three sodium ions bind to the transport domain, which subsequently triggers transmembrane elevator-like motion of the transporter across the plasma membrane.; DOMAIN: The beta-hairpin (aa 204-224) located between the helical segments of TM4 protrudes in the extracellular space and forms a docking platform for proteins of retroviral origin.
Region
204..224; Beta-hairpin; 511..541; Disordered
Protein Families (2)
- Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
- SLC1A5 subfamily
Sequence Similarities
Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A5 subfamily.
Clinical Relevance
Supporting Publications25
| PMID | Title | Related sentences |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33114768 | Proteomic Profiling of Two Distinct Populations of Extracellular Vesicles Isolated from Human Seminal Plasma. | No related sentences available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 36635400 | Proteomic profiling of urinary small extracellular vesicles in children with pneumonia: a pilot study. | No related sentences available |
| 37862381 | Surfaceome analysis of extracellular vesicles from senescent cells uncovers uptake repressor DPP4. | Surfaceome analysis of extracellular vesicles from senescent cells uncovers uptake repressor DPP4. |
| 38136601 | Identification of Central Nervous System Oncologic Disease Biomarkers in EVs from Cerebrospinal Fluid (CSF) of Pediatric Patients: A Pilot Neuro-Proteomic Study. | No related sentences available |
| 38441169 | Identifying a core protein signature of small extracellular vesicles derived from B-cell precursor acute lymphoblastic leukaemia. | No related sentences available |
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No related sentences available |
| 38564289 | Proteomic profiles of peritoneal fluid-derived small extracellular vesicles correlate with patient outcome in ovarian cancer. | No related sentences available |
| 39949490 | CRISPR-dCas9 Activation of TSG-6 in MSCs Modulates the Cargo of MSC-Derived Extracellular Vesicles and Attenuates Inflammatory Responses in Human Intervertebral Disc Cells In Vitro. | No related sentences available |