Protein detail
UBE2S
Ubiquitin-conjugating enzyme E2 S (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme S) (E2-EPF) (Ubiquitin carrier protein S) (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-conjugating enzyme E2-EPF5) (Ubiquitin-protein ligase S)
Entry name UBE2S | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 5 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Ubiquitin-conjugating enzyme E2 S (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme S) (E2-EPF) (Ubiquitin carrier protein S) (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-conjugating enzyme E2-EPF5) (Ubiquitin-protein ligase S)
Protein Class (3)
EnzymesMetabolic proteinsPredicted intracellular proteins
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
E2-EPF
Gene Description
Ubiquitin conjugating enzyme E2 S
Chromosome
19
Position
55399745-55407788
Supporting publications (n)
5
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue SpecificplacentaCell SpecificCytotrophoblastsSingle-Nuclei Brain Specificmedium spiny neuron
Function & Pathway7
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Cellular Component (4)
Molecular Function (5)
Biological Process (3)
Reactome (34)
- R-hsa-9687136 aberrant regulation of mitotic exit in cancer due to rb1 defects
- R-hsa-176814 activation of apc c and apc c cdc20 mediated degradation of mitotic proteins
- R-hsa-1280218 adaptive immune system
- R-hsa-983168 antigen processing ubiquitination proteasome degradation
- R-hsa-179409 apc cdc20 mediated degradation of nek2a
- R-hsa-174048 apc c cdc20 mediated degradation of cyclin b
- R-hsa-174178 apc c cdh1 mediated degradation of cdc20 and other apc c cdh1 targeted proteins in late mitosis early g1
- R-hsa-174143 apc c mediated degradation of cell cycle proteins
- R-hsa-69017 cdk mediated phosphorylation and removal of cdc6
- R-hsa-8953897 cellular responses to stimuli
Page 1 of 4
Mediation Categories (3)
Clinical-translation mediationImmune mediationMetabolism mediation
Relations & Evidence25
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| UBE2S | AKT1 | P31749 | T | 152 | phosphorylation | SIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:27593939ProtMapper:27593939ProtMapper:29562639 |
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (13)
13 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| UBE2S | Q16763 | COMPLEX:P30260_Q13042_Q8NHZ8_Q9BS18_Q9H1A4_Q9NYG5_Q9UJX2_Q9UJX3_Q9UJX4_Q9UJX5_Q9UJX6_Q9UM13 | Yes | Yes | No | SIGNOR | SIGNOR:19822757 | |
| AKT1 | P31749 | UBE2S | Q16763 | Yes | Yes | No | Sparser_ProtMapperiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:34123793ProtMapper:29562639PhosphoSite:27593939ProtMapper:27593939SIGNOR:27593939 |
| CDC20 | Q12834 | UBE2S | Q16763 | Yes | Yes | No | HINTSIGNOR | SIGNOR:19822757HINT:25306918HINT:25306923 |
| COMPLEX:P22314_P62979 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P22314_P62987 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P0CG47_P22314 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:P0CG48_P22314 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| XRCC6 | P12956 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:27593939 |
| FZR1 | Q9UM11 | UBE2S | Q16763 | Yes | Yes | No | WangHINTSIGNOR | HINT:25306923HINT:23708001HINT:25306918SIGNOR:19822757HINT:19822757 |
| COMPLEX:A0AVT1_P62987 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 |
Page 1 of 2Next
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Ub:E2 | UBBUBE2S | P0CG47Q16763 | 4:4 | SIGNORPDB | SIGNOR:SIGNOR-C497PDB:5bnb | |
| Ub:E2 | UBCUBE2S | P0CG48Q16763 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | RPS27AUBE2S | P62979Q16763 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | UBA52UBE2S | P62987Q16763 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| RNF40UBE2S | O75150Q16763 | 0:0 | hu.MAP | |||
| UBE2S | Q16763 | 2 | PDB | PDB:6s98PDB:7ahfPDB:6s96PDB:6qhkPDB:6qh3PDB:1zdn | ||
| RUSC1UBE2S | Q16763Q9BVN2 | 0:0 | hu.MAPhu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western BlottingMass Spectrometry | 1 | 36573687 |
Sequence, Structure & Domains12
Sequences
Length
222
Mass
23,845
Sequence
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
3D Structural Models
Turn
38..41; 54..57; 68..72
Helix
10..25; 96..100; 109..121; 125..127; 131..139; 141..155; 206..217; 218..220
Beta Strand
31..34; 42..48; 59..65; 76..81; 92..94
3D Structure
Electron microscopy (2); X-ray crystallography (7)
Domain & Motif Annotations
Compositional Bias
208..222; Basic residues
Domain (FT)
11..157; UBC core
Region
156..222; Disordered
Protein Families
Ubiquitin-conjugating enzyme family
Sequence Similarities
Belongs to the ubiquitin-conjugating enzyme family.
Clinical Relevance4
Supporting Publications5
| PMID | Title | Abstract |
|---|---|---|
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No abstract available |
| 27312428 | A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer. | No abstract available |
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No abstract available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 39873726 | Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer. | No abstract available |