Protein detail
UBE2S
Ubiquitin-conjugating enzyme E2 S (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme S) (E2-EPF) (Ubiquitin carrier protein S) (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-conjugating enzyme E2-EPF5) (Ubiquitin-protein ligase S)
Entry name UBE2S | UniProt ID | EVMP score 0.38 |
Frequency 5 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Ubiquitin-conjugating enzyme E2 S (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme S) (E2-EPF) (Ubiquitin carrier protein S) (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-conjugating enzyme E2-EPF5) (Ubiquitin-protein ligase S)
Protein Class
EnzymesMetabolic proteinsPredicted intracellular proteins
Protein Function
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
E2-EPF
Gene Description
Ubiquitin conjugating enzyme E2 S
Chromosome
19
Position
55399745-55407788
Frequency
5
EVMP Score
0.38
Fluorescence & Localization
Tissue SpecificplacentaCell SpecificCytotrophoblastsSingle-Nuclei Brain Specificmedium spiny neuron
Function & Pathway
Protein Function
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
Reactome
- R-hsa-9687136 aberrant regulation of mitotic exit in cancer due to rb1 defects
- R-hsa-176814 activation of apc c and apc c cdc20 mediated degradation of mitotic proteins
- R-hsa-1280218 adaptive immune system
- R-hsa-983168 antigen processing ubiquitination proteasome degradation
- R-hsa-179409 apc cdc20 mediated degradation of nek2a
- R-hsa-174048 apc c cdc20 mediated degradation of cyclin b
- R-hsa-174178 apc c cdh1 mediated degradation of cdc20 and other apc c cdh1 targeted proteins in late mitosis early g1
- R-hsa-174143 apc c mediated degradation of cell cycle proteins
- R-hsa-69017 cdk mediated phosphorylation and removal of cdc6
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-2559583 cellular senescence
- R-hsa-1640170 cell cycle
- R-hsa-69620 cell cycle checkpoints
- R-hsa-69278 cell cycle mitotic
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-176407 conversion from apc c cdc20 to apc c cdh1 in late anaphase
- R-hsa-9675126 diseases of mitotic cell cycle
- R-hsa-69306 dna replication
- R-hsa-69002 dna replication pre initiation
- R-hsa-141405 inhibition of the proteolytic activity of apc c required for the onset of anaphase by mitotic spindle checkpoint components
- R-hsa-2555396 mitotic metaphase and anaphase
- R-hsa-69618 mitotic spindle checkpoint
- R-hsa-68886 m phase
- R-hsa-176412 phosphorylation of the apc c
- R-hsa-597592 post translational protein modification
- R-hsa-8852135 protein ubiquitination
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-2559582 senescence associated secretory phenotype sasp
- R-hsa-2467813 separation of sister chromatids
- R-hsa-69052 switching of origins to a post replicative state
- R-hsa-8866652 synthesis of active ubiquitin roles of e1 and e2 enzymes
- R-hsa-69239 synthesis of dna
- R-hsa-69242 s phase
- R-hsa-8853884 transcriptional regulation by ventx
Mediation Categories
Clinical-translation mediationImmune mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| UBE2S | AKT1 | P31749 | T | 152 | phosphorylation | SIGNORProtMapperRLIMS-P_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:27593939ProtMapper:27593939ProtMapper:29562639 |
Ligand-Receptor Signaling
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
13 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| COMPLEX:A0AVT1_P0CG47 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:A0AVT1_P62979 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 | |
| COMPLEX:A0AVT1_P0CG48 | UBE2S | Q16763 | Yes | Yes | No | SIGNOR | SIGNOR:34199813 |
Page 2 of 2Previous
Protein Complex Composition
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Ub:E2 | UBBUBE2S | P0CG47Q16763 | 4:4 | SIGNORPDB | SIGNOR:SIGNOR-C497PDB:5bnb | |
| Ub:E2 | UBCUBE2S | P0CG48Q16763 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | RPS27AUBE2S | P62979Q16763 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| Ub:E2 | UBA52UBE2S | P62987Q16763 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C497 | |
| RNF40UBE2S | O75150Q16763 | 0:0 | hu.MAP | |||
| UBE2S | Q16763 | 2 | PDB | PDB:6s98PDB:7ahfPDB:6s96PDB:6qhkPDB:6qh3PDB:1zdn | ||
| RUSC1UBE2S | Q16763Q9BVN2 | 0:0 | hu.MAPhu.MAP2 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western BlottingMass Spectrometry | 1 | 36573687 |
Sequence, Structure & Domains
Sequences
Length
222
Mass
23,845
Sequence
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
3D Structural Models
Turn
38..41; 54..57; 68..72
Helix
10..25; 96..100; 109..121; 125..127; 131..139; 141..155; 206..217; 218..220
Beta Strand
31..34; 42..48; 59..65; 76..81; 92..94
3D Structure
Electron microscopy (2); X-ray crystallography (7)
Domain & Motif Annotations
Compositional Bias
208..222; Basic residues
Domain (FT)
11..157; UBC core
Region
156..222; Disordered
Protein Families
Ubiquitin-conjugating enzyme family
Sequence Similarities
Belongs to the ubiquitin-conjugating enzyme family.