Protein detail

IMPG1

Interphotoreceptor matrix proteoglycan 1 (Interphotoreceptor matrix proteoglycan of 150 kDa) (IPM-150) (Sialoprotein associated with cones and rods)

Entry name IMPG1	UniProt ID Q17R60	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Interphotoreceptor matrix proteoglycan 1 (Interphotoreceptor matrix proteoglycan of 150 kDa) (IPM-150) (Sialoprotein associated with cones and rods)

Protein Class (4)

Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted secreted proteins

Protein Function (4)

Disease related genes
Predicted secreted proteins
Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Eye disease

Ensembl

ENSG00000112706

Entrez Gene Symbol

IMPG1

Gene Synonym (3)

GP147IPM150SPACR

Gene Description

Interphotoreceptor matrix proteoglycan 1

Chromosome

Position

75921114-76072678

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization3

Cell SpecificDistal convoluted tubule cellsSingle-Nuclei Brain Specificleukocyte

Function & Pathway6

Protein Function (4)

Disease related genes
Predicted secreted proteins
Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Eye disease

Cellular Component (5)

Molecular Function (4)

Biological Process (3)

Canonical Pathways

M185 Pid alk1 pathway

Mediation Categories

Other mediation

Relations & Evidence13

Ligand-Receptor Signaling (12)

12 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
ecm	ecm	MatrixDB	Yes	No	Yes	No	No
ecm	ecm	GO_Intercell	Yes	No	Yes	No	No
ecm	ecm	UniProt_location	Yes	No	Yes	No	No
ecm	ecm	CellCellInteractions	Yes	No	Yes	No	No
ecm	ecm	OmniPath	Yes	No	Yes	No	No
extracellular	extracellular	LOCATE	No	No	Yes	No	No
extracellular	extracellular	OmniPath	No	No	Yes	No	No
secreted	secreted	UniProt_keyword	No	No	Yes	No	No
secreted	secreted	UniProt_location	No	No	Yes	No	No
secreted	secreted	HPA_secretome	No	No	Yes	No	No

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	5	38731868 24505114 26801919 40098346 31588238

Sequence, Structure & Domains7

Sequences

Length

797

Mass

89,387

Sequence

MYLETRRAIFVFWIFLQVQGTKDISINIYHSETKDIDNPPRNETTESTEKMYKMSTMRRIFDLAKHRTKRSAFFPTGVKVCPQESMKQILDSLQAYYRLRVCQEAVWEAYRIFLDRIPDTGEYQDWVSICQQETFCLFDIGKNFSNSQEHLDLLQQRIKQRSFPDRKDEISAEKTLGEPGETIVISTDVANVSLGPFPLTPDDTLLNEILDNTLNDTKMPTTERETEFAVLEEQRVELSVSLVNQKFKAELADSQSPYYQELAGKSQLQMQKIFKKLPGFKKIHVLGFRPKKEKDGSSSTEMQLTAIFKRHSAEAKSPASDLLSFDSNKIESEEVYHGTMEEDKQPEIYLTATDLKRLISKALEEEQSLDVGTIQFTDEIAGSLPAFGPDTQSELPTSFAVITEDATLSPELPPVEPQLETVDGAEHGLPDTSWSPPAMASTSLSEAPPFFMASSIFSLTDQGTTDTMATDQTMLVPGLTIPTSDYSAISQLALGISHPPASSDDSRSSAGGEDMVRHLDEMDLSDTPAPSEVPELSEYVSVPDHFLEDTTPVSALQYITTSSMTIAPKGRELVVFFSLRVANMAFSNDLFNKSSLEYRALEQQFTQLLVPYLRSNLTGFKQLEILNFRNGSVIVNSKMKFAKSVPYNLTKAVHGVLEDFRSAAAQQLHLEIDSYSLNIEPADQADPCKFLACGEFAQCVKNERTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGN

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q17R60-1; Sequence=Displayed; Name=2; IsoId=Q17R60-2; Sequence=VSP_055981, VSP_055982, VSP_055983

Alternative Sequence

23..100; Missing (in isoform 2); 188..225; DVANVSLGPFPLTPDDTLLNEILDNTLNDTKMPTTERE -> EKNKGKTKPFNILQFGNNHHEHLLPIFCLLSSIIYTYY (in isoform 2); 226..797; Missing (in isoform 2)

Domain & Motif Annotations

Motif

621..629; Heparin- and hyaluronan-binding

Domain (FT)

232..354; SEA 1; 571..684; SEA 2

Clinical Relevance2

Disease Involvement (2)

Disease variantRetinitis pigmentosa

Antibody (3)

HPA027142 HPA030332 HPA030333

Supporting Publications1

PMID	Title	Abstract
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available