Protein detail
MICA
MHC class I polypeptide-related sequence A (MIC-A)
Protein symbol MICA | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 1 | Protein classification |
Basic Information
Protein Names
MHC class I polypeptide-related sequence A (MIC-A)
Protein Function
Predicted intracellular proteins
Transmembrane
308..328; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
KEGG
Reactome
Canonical Pathways
- M82 Pid ret pathway
- M142 Pid ajdiss 2pathway
Mediation Categories
Fusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | No | Yes | Yes | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | Yes | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
11 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| MICAL2RAB10 | O94851P61026 | 1:1 | PDB | PDB:5szj | ||
| MICAL2RAB1B | O94851Q9H0U4 | 1:1 | PDB | PDB:5szhPDB:5szk | ||
| MICAL1RAB10 | P61026Q8TDZ2 | 2:1 | PDB | PDB:9g0dPDB:9g0cPDB:5lpn | ||
| KIF23MICAL3RACGAP1SHCBP1 | Q02241Q7RTP6Q8NEM2Q9H0H5 | 0:0:0:0 | hu.MAP | |||
| MDC1MICALL1RTKN2SH3KBP1STAP1 | Q14676Q8IZC4Q8N3F8Q96B97Q9ULZ2 | 0:0:0:0:0 | hu.MAP2 | |||
| MDC1MICALL1RTKN2SH3BP1SH3KBP1 | Q14676Q8IZC4Q8N3F8Q96B97Q9Y3L3 | 0:0:0:0:0 | hu.MAP2 | |||
| MICA | Q29983 | 2 | PDB | PDB:8tlz | ||
| MICAPHF7 | Q29983Q9BWX1 | 0:0 | hu.MAP | |||
| CERKLMICAL3 | Q49MI3Q7RTP6 | 0:0 | hu.MAP2 | |||
| MICAL3 | Q7RTP6 | 2 | PDB | PDB:5szg |
Page 1 of 2Next
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
383
Mass
42,915
Sequence
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=MICA1; IsoId=Q29983-1; Sequence=Displayed; Name=2; Synonyms=MICA2; IsoId=Q29983-2; Sequence=VSP_055366
Alternative Sequence
109..204; Missing (in isoform 2)
3D Structural Models
Turn
87..90; 145..148; 198..200
Helix
79..81; 83..86; 91..101; 156..171; 177..197; 217..219; 248..250; 277..279
Beta Strand
26..37; 46..51; 54..60; 63..65; 71..75; 109..121; 127..135; 138..144; 149..151; 208..214; 220..233; 236..241; 251..253; 260..262; 264..273; 280..286; 289..294
3D Structure
X-ray crystallography (10)
Domain & Motif Annotations
Domain (FT)
207..296; Ig-like C1-type
Protein Families
- MHC class I family
- MIC subfamily
Sequence Similarities
Belongs to the MHC class I family. MIC subfamily.