Protein detail
T4S20
Transmembrane 4 L6 family member 20
Entry name T4S20 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 4 | Protein classification Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Transmembrane 4 L6 family member 20
Protein Class (5)
Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (4)
- Disease related genes
- Predicted intracellular proteins
- Transporters:Accessory Factors Involved in Transport
- Potential drug targets
Transmembrane
15..35; Helical; 45..65; Helical; 84..104; Helical; 186..206; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ22800TCCE518
Gene Description
Transmembrane 4 L six family member 20
Chromosome
2
Position
227362038-227381995
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Cell SpecificAdipocytesBlood Cell Specificmemory CD8 T-cellBlood Lineage SpecificT-cells
Function & Pathway6
Protein Function (4)
- Disease related genes
- Predicted intracellular proteins
- Transporters:Accessory Factors Involved in Transport
- Potential drug targets
Cellular Component (4)
Molecular Function
Biological Process (3)
Canonical Pathways (3)
- M273 Pid epha2 fwd pathway
- M268 Pid s1p s1p2 pathway
- M76 Pid p38 alpha beta pathway
Mediation Categories
Adhesion and uptake mediation
Relations & Evidence14
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
| cell_surface | cell_surface | OmniPath | No | No | No | No | No |
Page 1 of 2Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
Sequence, Structure & Domains6
Sequences
Length
229
Mass
25,075
Sequence
MTCCEGWTSCNGFSLLVLLLLGVVLNAIPLIVSLVEEDQFSQNPISCFEWWFPGIIGAGLMAIPATTMSLTARKRACCNNRTGMFLSSLFSVITVIGALYCMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGLLLVGILEVLFGLSQIVIGFLGCLCGVSKRRSQIV
Domain & Motif Annotations
Domain (CC)
The first transmembrane helix plays a critical role for the insertion orientation in the endoplasmic reticulum membrane.
Protein Families
L6 tetraspanin family
Sequence Similarities
Belongs to the L6 tetraspanin family.
Clinical Relevance2
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No abstract available |