Protein detail
FBLN7
Fibulin-7 (FIBL-7)
Protein symbol FBLN7 | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Fibulin-7 (FIBL-7)
Protein Function
- Predicted secreted proteins
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Function & Pathway
Protein Function
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component
Molecular Function
Mediation Categories
Adhesion and uptake mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
14 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | Yes | No | No |
| ecm | ecm | UniProt_location | Yes | No | Yes | No | No |
| ecm | ecm | CellCellInteractions | Yes | No | Yes | No | No |
| fibulin | ecm | HGNC | Yes | No | Yes | No | No |
| ecm | ecm | OmniPath | Yes | No | Yes | No | No |
| matrix_adhesion | matrix_adhesion | Zhong2015 | No | Yes | Yes | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | No | No |
| matrix_adhesion | matrix_adhesion | OmniPath | No | Yes | Yes | No | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | No | No |
| secreted | secreted | UniProt_location | No | No | Yes | No | No |
Page 1 of 2Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains
Sequences
Length
439
Mass
47,376
Sequence
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q53RD9-1; Sequence=Displayed; Name=2; IsoId=Q53RD9-2; Sequence=VSP_030086; Name=3; IsoId=Q53RD9-3; Sequence=VSP_030084; Name=4; IsoId=Q53RD9-4; Sequence=VSP_030085
Alternative Sequence
1..57; Missing (in isoform 3); 136..269; Missing (in isoform 4); 178..223; Missing (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Coiled Coil
28..53
Domain (FT)
79..136; Sushi; 136..172; EGF-like 1; calcium-binding; 224..269; EGF-like 2; calcium-binding; 270..319; EGF-like 3; calcium-binding
Protein Families
Fibulin family
Sequence Similarities
Belongs to the fibulin family.