Protein detail
FBLN7
Fibulin-7 (FIBL-7)
Entry name FBLN7 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Fibulin-7 (FIBL-7)
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Function & Pathway
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (3)
Mediation Categories
Adhesion and uptake mediation
Relations & Evidence17
Ligand-Receptor Signaling (14)
14 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | Yes | |||
| ecm | ecm | UniProt_location | Yes | Yes | |||
| ecm | ecm | CellCellInteractions | Yes | Yes | |||
| fibulin | ecm | HGNC | Yes | Yes | |||
| ecm | ecm | OmniPath | Yes | Yes | |||
| matrix_adhesion | matrix_adhesion | Zhong2015 | Yes | Yes | |||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| matrix_adhesion | matrix_adhesion | OmniPath | Yes | Yes | |||
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes |
Page 1 of 2Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains
Sequences
Length
439
Mass
47,376
Sequence
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q53RD9-1; Sequence=Displayed; Name=2; IsoId=Q53RD9-2; Sequence=VSP_030086; Name=3; IsoId=Q53RD9-3; Sequence=VSP_030084; Name=4; IsoId=Q53RD9-4; Sequence=VSP_030085
Alternative Sequence
1..57; Missing (in isoform 3); 136..269; Missing (in isoform 4); 178..223; Missing (in isoform 2)
Domain & Motif Annotations
Coiled Coil
28..53
Domain (FT)
79..136; Sushi; 136..172; EGF-like 1; calcium-binding; 224..269; EGF-like 2; calcium-binding; 270..319; EGF-like 3; calcium-binding
Protein Families
Fibulin family
Sequence Similarities
Belongs to the fibulin family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 27605433 | Secreted primary human malignant mesothelioma exosome signature reflects oncogenic cargo. | No related sentences available |