Protein detail

FBLN7

Fibulin-7 (FIBL-7)

Entry name FBLN7	UniProt ID Q53RD9	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

Fibulin-7 (FIBL-7)

Protein Function (2)

Predicted secreted proteins
Predicted intracellular proteins

Ensembl

ENSG00000144152

Entrez Gene Symbol

FBLN7

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Function & Pathway4

Protein Function (2)

Predicted secreted proteins
Predicted intracellular proteins

Cellular Component (3)

Molecular Function (3)

Mediation Categories

Adhesion and uptake mediation

Relations & Evidence17

Ligand-Receptor Signaling (14)

14 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
secreted	secreted	HPA_secretome	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No
glycoprotein	ecm	Matrisome	Yes	No	Yes	No	No
fibulin	ecm	Matrisome	Yes	No	Yes	No	No

Page 2 of 2Previous

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ASPH FAM162A FBLN7 MCU MCUB STEAP3	Q12797 Q53RD9 Q658P3 Q8NE86 Q96A26 Q9NWR8	0:0:0:0:0:0	hu.MAP2
	ASPH FAM162A FBLN7 MCU MCUB	Q12797 Q53RD9 Q8NE86 Q96A26 Q9NWR8	0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Polymer Precipitation	Western blotting	1	38731868

Sequence, Structure & Domains9

Sequences

Length

439

Mass

47,376

Sequence

MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKSRLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q53RD9-1; Sequence=Displayed; Name=2; IsoId=Q53RD9-2; Sequence=VSP_030086; Name=3; IsoId=Q53RD9-3; Sequence=VSP_030084; Name=4; IsoId=Q53RD9-4; Sequence=VSP_030085

Alternative Sequence

1..57; Missing (in isoform 3); 136..269; Missing (in isoform 4); 178..223; Missing (in isoform 2)

Domain & Motif Annotations

Coiled Coil

28..53

Domain (FT)

79..136; Sushi; 136..172; EGF-like 1; calcium-binding; 224..269; EGF-like 2; calcium-binding; 270..319; EGF-like 3; calcium-binding

Protein Families

Fibulin family

Sequence Similarities

Belongs to the fibulin family.

Supporting Publications1

PMID	Title	Abstract
27605433	Secreted primary human malignant mesothelioma exosome signature reflects oncogenic cargo.	No abstract available