Protein detail

ULBP6

UL16-binding protein 6 (Retinoic acid early transcript 1L protein)

Entry name ULBP6	UniProt ID Q5VY80	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information5

Protein Names

UL16-binding protein 6 (Retinoic acid early transcript 1L protein)

Ensembl

ENSG00000155918

Entrez Gene Symbol

RAET1L

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization6

Tissue SpecificesophagusBrain Regional SpecificponsCell SpecificBasal keratinocytesSingle-Nuclei Brain Specifichippocampal dentate gyrusBlood Cell SpecificMAIT T-cellBlood Lineage SpecificT-cells

Function & Pathway6

Cellular Component (6)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG

hsa04650 Natural killer cell mediated cytotoxicity

Reactome (2)

Mediation Categories (3)

Fusion and delivery mediationImmune mediationMetabolism mediation

Relations & Evidence27

Ligand-Receptor Signaling (26)

26 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	DGIdb	No	No	No	No	No
extracellular	extracellular	OmniPath	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
cell_surface_ligand	cell_surface_ligand	connectomeDB2020	Yes	No	No	No	No
cell_surface_ligand	cell_surface_ligand	CellChatDB	Yes	No	No	No	No
cell_surface_ligand	cell_surface_ligand	CellPhoneDB	Yes	No	No	No	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	No	No	No

Page 1 of 3Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Western blottingELISA	5	40928027 32795414 26775013 31320591 33905554

Sequence, Structure & Domains10

Sequences

Length

246

Mass

27,509

Sequence

MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI

3D Structural Models

Turn

66..68; 77..81; 153..156

Helix

41..43; 86..107; 163..165; 166..174; 176..187; 189..199

Beta Strand

31..39; 49..58; 60..65; 71..73; 82..85; 116..118; 121..129; 131..133; 135..143; 146..152; 157..160

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Region

29..117; MHC class I alpha-1 like; 118..210; MHC class I alpha-2 like

Protein Families

MHC class I family

Sequence Similarities

Belongs to the MHC class I family.

Supporting Publications1

PMID	Title	Abstract
27605433	Secreted primary human malignant mesothelioma exosome signature reflects oncogenic cargo.	No abstract available