Protein detail
ULBP6
UL16-binding protein 6 (Retinoic acid early transcript 1L protein)
Entry name ULBP6 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information5
Protein Names
UL16-binding protein 6 (Retinoic acid early transcript 1L protein)
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization6
Tissue SpecificesophagusBrain Regional SpecificponsCell SpecificBasal keratinocytesSingle-Nuclei Brain Specifichippocampal dentate gyrusBlood Cell SpecificMAIT T-cellBlood Lineage SpecificT-cells
Function & Pathway6
Cellular Component (6)
Molecular Function
Biological Process (3)
Reactome (2)
Mediation Categories (3)
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence27
Ligand-Receptor Signaling (26)
26 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Sequence, Structure & Domains10
Sequences
Length
246
Mass
27,509
Sequence
MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
3D Structural Models
Turn
66..68; 77..81; 153..156
Helix
41..43; 86..107; 163..165; 166..174; 176..187; 189..199
Beta Strand
31..39; 49..58; 60..65; 71..73; 82..85; 116..118; 121..129; 131..133; 135..143; 146..152; 157..160
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Region
29..117; MHC class I alpha-1 like; 118..210; MHC class I alpha-2 like
Protein Families
MHC class I family
Sequence Similarities
Belongs to the MHC class I family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 27605433 | Secreted primary human malignant mesothelioma exosome signature reflects oncogenic cargo. | No abstract available |