Protein detail
ANO1
Anoctamin-1 (Discovered on gastrointestinal stromal tumors protein 1) (Oral cancer overexpressed protein 2) (Transmembrane protein 16A) (Tumor-amplified and overexpressed sequence 2)
Protein symbol ANO1 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 10 | Protein classification Disease related genesFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Anoctamin-1 (Discovered on gastrointestinal stromal tumors protein 1) (Oral cancer overexpressed protein 2) (Transmembrane protein 16A) (Tumor-amplified and overexpressed sequence 2)
Protein Class
Disease related genesFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Disease related genes
- Transporters:Transporter channels and pores
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Transmembrane
334..354; Helical; 407..427; Helical; 520..540; Helical; 569..589; Helical; 608..628; Helical; 658..678; Helical; 726..746; Helical; 747..767; Helical; 785..805; Helical; 893..913; Helical
Transmembrane Count
10
Ensembl
Entrez Gene Symbol
Gene Synonym
DOG1FLJ10261ORAOV2TAOS2TMEM16A
Gene Description
Anoctamin 1
Chromosome
11
Position
69985907-70189530
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecifictestisCell SpecificDistal convoluted tubule cellsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
- Disease related genes
- Transporters:Transporter channels and pores
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Cellular Component
Molecular Function
- GO:0005102 signaling receptor binding
- GO:0005227 calcium-activated cation channel activity
- GO:0005229 intracellularly calcium-gated chloride channel activity
- GO:0005247 voltage-gated chloride channel activity
- GO:0005254 chloride channel activity
- GO:0005515 protein binding
- GO:0015111 iodide transmembrane transporter activity
- GO:0042802 identical protein binding
- GO:0042803 protein homodimerization activity
- GO:0046872 metal ion binding
Biological Process
Reactome
- R-hsa-9733458 induction of cell cell fusion
- R-hsa-5663205 infectious disease
- R-hsa-983712 ion channel transport
- R-hsa-9772573 late sars cov 2 infection events
- R-hsa-9694516 sars cov 2 infection
- R-hsa-9679506 sars cov infections
- R-hsa-2672351 stimuli sensing channels
- R-hsa-382551 transport of small molecules
- R-hsa-9824446 viral infection pathways
Canonical Pathways
- M83 Pid cdc42 reg pathway
- M241 Pid rac1 reg pathway
Mediation Categories
Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
18 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| ion_channel | ion_channel | DGIdb | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| ion_channel | ion_channel | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 30915084 |
Sequence, Structure & Domains
Sequences
Length
986
Mass
114,078
Sequence
MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSPPDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=TMEM16A(ac); IsoId=Q5XXA6-1; Sequence=Displayed; Name=2; IsoId=Q5XXA6-2; Sequence=VSP_025665, VSP_025668, VSP_025669; Name=3; IsoId=Q5XXA6-3; Sequence=VSP_025666, VSP_025667, VSP_025668, VSP_025669, VSP_025670, VSP_025671; Name=4; Synonyms=TMEM16A(ac-delta-e3); IsoId=Q5XXA6-4; Sequence=VSP_061540, VSP_025669; Name=5; Synonyms=Ano1(+0); IsoId=Q5XXA6-5; Sequence=VSP_061539, VSP_061541
Alternative Sequence
1..116; Missing (in isoform 2); 1..28; Missing (in isoform 3); 1; M -> MQEGDIGLEGLPPREVPTVEAAGAVDGEGAPPGGPSAQAATM (in isoform 5); 29..36; GYLPSEGT -> MLTRPSQV (in isoform 3); 148..180; Missing (in isoform 4); 267; G -> GQGEGRKKDSALLSKRRKCGKYG (in isoform 5); 448..451; Missing (in isoform 2 and isoform 3); 476..501; Missing (in isoform 2, isoform 3 and isoform 4); 651..700; CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP -> VTEILFISGSPFCLAYDLSTPCTWEKQLQHICSAKSSRFLSFLLETFLFP (in isoform 3); 701..986; Missing (in isoform 3)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
951..960; Basic and acidic residues
Domain (CC)
The region spanning the fifth and sixth transmembrane domains probably forms the pore-forming region.
Region
79..121; Disordered; 951..986; Disordered
Protein Families
Anoctamin family
Sequence Similarities
Belongs to the anoctamin family.
Clinical Relevance
Disease Involvement
Disease variantFDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs