Protein detail
ANO1
Anoctamin-1 (Discovered on gastrointestinal stromal tumors protein 1) (Oral cancer overexpressed protein 2) (Transmembrane protein 16A) (Tumor-amplified and overexpressed sequence 2)
Entry name ANO1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 10 | Protein classification Disease related genesFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Anoctamin-1 (Discovered on gastrointestinal stromal tumors protein 1) (Oral cancer overexpressed protein 2) (Transmembrane protein 16A) (Tumor-amplified and overexpressed sequence 2)
Protein Class (6)
Disease related genesFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (4)
- Disease related genes
- Transporters:Transporter channels and pores
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Transmembrane
334..354; Helical; 407..427; Helical; 520..540; Helical; 569..589; Helical; 608..628; Helical; 658..678; Helical; 726..746; Helical; 747..767; Helical; 785..805; Helical; 893..913; Helical
Transmembrane Count
10
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
DOG1FLJ10261ORAOV2TAOS2TMEM16A
Gene Description
Anoctamin 1
Chromosome
11
Position
69985907-70189530
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecifictestisCell SpecificDistal convoluted tubule cellsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (4)
- Disease related genes
- Transporters:Transporter channels and pores
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Cellular Component (7)
Molecular Function (10)
- GO:0005102 signaling receptor binding
- GO:0005227 calcium-activated cation channel activity
- GO:0005229 intracellularly calcium-gated chloride channel activity
- GO:0005247 voltage-gated chloride channel activity
- GO:0005254 chloride channel activity
- GO:0005515 protein binding
- GO:0015111 iodide transmembrane transporter activity
- GO:0042802 identical protein binding
- GO:0042803 protein homodimerization activity
- GO:0046872 metal ion binding
Biological Process (3)
Reactome (9)
- R-hsa-9733458 induction of cell cell fusion
- R-hsa-5663205 infectious disease
- R-hsa-983712 ion channel transport
- R-hsa-9772573 late sars cov 2 infection events
- R-hsa-9694516 sars cov 2 infection
- R-hsa-9679506 sars cov infections
- R-hsa-2672351 stimuli sensing channels
- R-hsa-382551 transport of small molecules
- R-hsa-9824446 viral infection pathways
Canonical Pathways (2)
- M83 Pid cdc42 reg pathway
- M241 Pid rac1 reg pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence20
Ligand-Receptor Signaling (18)
18 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| apical_cell_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| cell_surface | cell_surface | Surfaceome | |||||
| cell_surface | cell_surface | OmniPath | |||||
| receptor | receptor | scConnect | Yes | ||||
| transmembrane | transmembrane_predicted | Phobius |
Page 2 of 2Previous
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 30915084 |
Sequence, Structure & Domains
Sequences
Length
986
Mass
114,078
Sequence
MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGLELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSPPDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=TMEM16A(ac); IsoId=Q5XXA6-1; Sequence=Displayed; Name=2; IsoId=Q5XXA6-2; Sequence=VSP_025665, VSP_025668, VSP_025669; Name=3; IsoId=Q5XXA6-3; Sequence=VSP_025666, VSP_025667, VSP_025668, VSP_025669, VSP_025670, VSP_025671; Name=4; Synonyms=TMEM16A(ac-delta-e3); IsoId=Q5XXA6-4; Sequence=VSP_061540, VSP_025669; Name=5; Synonyms=Ano1(+0); IsoId=Q5XXA6-5; Sequence=VSP_061539, VSP_061541
Alternative Sequence
1..116; Missing (in isoform 2); 1..28; Missing (in isoform 3); 1; M -> MQEGDIGLEGLPPREVPTVEAAGAVDGEGAPPGGPSAQAATM (in isoform 5); 29..36; GYLPSEGT -> MLTRPSQV (in isoform 3); 148..180; Missing (in isoform 4); 267; G -> GQGEGRKKDSALLSKRRKCGKYG (in isoform 5); 448..451; Missing (in isoform 2 and isoform 3); 476..501; Missing (in isoform 2, isoform 3 and isoform 4); 651..700; CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP -> VTEILFISGSPFCLAYDLSTPCTWEKQLQHICSAKSSRFLSFLLETFLFP (in isoform 3); 701..986; Missing (in isoform 3)
Domain & Motif Annotations
Compositional Bias
951..960; Basic and acidic residues
Domain (CC)
The region spanning the fifth and sixth transmembrane domains probably forms the pore-forming region.
Region
79..121; Disordered; 951..986; Disordered
Protein Families
Anoctamin family
Sequence Similarities
Belongs to the anoctamin family.
Clinical Relevance
Disease Involvement (2)
Disease variantFDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |