Protein detail

STEA4

Metalloreductase STEAP4 (EC 1.16.1.-) (Six-transmembrane epithelial antigen of prostate 4) (SixTransMembrane protein of prostate 2) (Tumor necrosis factor, alpha-induced protein 9)

Entry name STEA4	UniProt ID Q687X5	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 6	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Metalloreductase STEAP4 (EC 1.16.1.-) (Six-transmembrane epithelial antigen of prostate 4) (SixTransMembrane protein of prostate 2) (Tumor necrosis factor, alpha-induced protein 9)

Protein Function (3)

Transporters:Transport Electron Carriers
Enzymes
ENZYME proteins:Oxidoreductases

Transmembrane

202..224; Helical; 236..256; Helical; 293..313; Helical; 342..362; Helical; 381..401; Helical; 419..439; Helical

Transmembrane Count

Ensembl

ENSG00000127954

Entrez Gene Symbol

STEAP4

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Cell SpecificChoroid plexus epithelial cells

Function & Pathway6

Protein Function (3)

Transporters:Transport Electron Carriers
Enzymes
ENZYME proteins:Oxidoreductases

Cellular Component (8)

Molecular Function (6)

Biological Process (3)

Reactome (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence22

Ligand-Receptor Signaling (20)

20 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	UniProt_location	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
transporter	transporter	Surfaceome	No	Yes	No	Yes	No
steap	transporter	Surfaceome	No	Yes	No	Yes	No
transporter	transporter	OmniPath	No	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No

Page 1 of 2Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	STEAP4	Q687X5	3	PDB	PDB:6hcyPDB:6hd1

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration	Western blottingFlow cytometry	3	32795414 38731868 38321535

Sequence, Structure & Domains12

Sequences

Length

459

Mass

51,981

Sequence

MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q687X5-1; Sequence=Displayed; Name=2; IsoId=Q687X5-2; Sequence=VSP_024833

Alternative Sequence

153..328; Missing (in isoform 2)

3D Structural Models

Turn

40..42; 71..73; 93..95; 239..242; 368..370; 404..407

Helix

29..39; 67..70; 87..92; 117..124; 139..144; 160..172; 183..185; 186..191; 192..194; 201..222; 225..228; 236..238; 243..256; 261..272; 283..287; 290..308; 311..313; 315..330; 339..365; 376..383; 385..403; 425..438; 440..449

Beta Strand

21..25; 44..48; 75..79; 100..103; 112..115; 128..132; 134..137; 148..150; 152..158; 176..179; 196..198; 275..277; 371..374; 413..415; 419..422

3D Structure

Electron microscopy (2)

Domain & Motif Annotations

Domain (FT)

247..395; Ferric oxidoreductase

Protein Families

STEAP family

Sequence Similarities

Belongs to the STEAP family.

Supporting Publications1

PMID	Title	Abstract
26739763	Triple SILAC quantitative proteomic analysis reveals differential abundance of cell signaling proteins between normal and lung cancer-derived exosomes.	Proteins associated with signal transduction, including EGFR, GRB2 and SRC, were enriched in NSCLC exosomes, and could actively regulate cell proliferation in recipient cells. To better understand the role of these microvesicles in lung carcinogenesis, we employed a Triple SILAC quantitative proteomic strategy to examine the differential protein abundance between exosomes derived from an immortalized normal bronchial epithelial cell line and two non-small cell lung cancer (NSCLC) cell lines harboring distinct activating mutations in the cell signaling molecules: Kirsten rat sarcoma viral oncogene homolog (KRAS) or epidermal growth factor receptor (EGFR).