Protein detail
STEA4
Metalloreductase STEAP4 (EC 1.16.1.-) (Six-transmembrane epithelial antigen of prostate 4) (SixTransMembrane protein of prostate 2) (Tumor necrosis factor, alpha-induced protein 9)
Entry name STEA4 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 6 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Metalloreductase STEAP4 (EC 1.16.1.-) (Six-transmembrane epithelial antigen of prostate 4) (SixTransMembrane protein of prostate 2) (Tumor necrosis factor, alpha-induced protein 9)
Protein Function
- Transporters:Transport Electron Carriers
- Enzymes
- ENZYME proteins:Oxidoreductases
Transmembrane
202..224; Helical; 236..256; Helical; 293..313; Helical; 342..362; Helical; 381..401; Helical; 419..439; Helical
Transmembrane Count
6
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificChoroid plexus epithelial cells
Function & Pathway
Protein Function
- Transporters:Transport Electron Carriers
- Enzymes
- ENZYME proteins:Oxidoreductases
Cellular Component
Molecular Function
Biological Process
Reactome
Mediation Categories
Fusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 2 of 2Previous
Regulatory Interaction Network
0 records.
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
459
Mass
51,981
Sequence
MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q687X5-1; Sequence=Displayed; Name=2; IsoId=Q687X5-2; Sequence=VSP_024833
Alternative Sequence
153..328; Missing (in isoform 2)
3D Structural Models
Turn
40..42; 71..73; 93..95; 239..242; 368..370; 404..407
Helix
29..39; 67..70; 87..92; 117..124; 139..144; 160..172; 183..185; 186..191; 192..194; 201..222; 225..228; 236..238; 243..256; 261..272; 283..287; 290..308; 311..313; 315..330; 339..365; 376..383; 385..403; 425..438; 440..449
Beta Strand
21..25; 44..48; 75..79; 100..103; 112..115; 128..132; 134..137; 148..150; 152..158; 176..179; 196..198; 275..277; 371..374; 413..415; 419..422
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Domain (FT)
247..395; Ferric oxidoreductase
Protein Families
STEAP family
Sequence Similarities
Belongs to the STEAP family.