Protein detail
ULBP5
UL-16 binding protein 5 (Retinoic acid early transcript 1G protein)
Entry name ULBP5 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 4 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
UL-16 binding protein 5 (Retinoic acid early transcript 1G protein)
Protein Function
Predicted secreted proteins
Transmembrane
224..243; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
4
EVMP confidence score
0.40
Function & Pathway
Protein Function
Predicted secreted proteins
Cellular Component (6)
Molecular Function (2)
Biological Process (3)
Reactome (2)
Canonical Pathways (3)
- M103 Pid s1p s1p1 pathway
- M55 Pid s1p s1p3 pathway
- M72 Pid nectin pathway
Mediation Categories (3)
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence44
Ligand-Receptor Signaling (43)
43 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | Yes | Yes | ||
| ecm | ecm | MatrixDB | Yes | Yes | Yes | ||
| ecm | ecm | OmniPath | Yes | Yes | Yes | ||
| extracellular | extracellular | DGIdb | Yes | Yes | |||
| extracellular | extracellular | OmniPath | Yes | Yes | |||
| intracellular | intracellular | ComPPI | Yes | Yes | |||
| intracellular | intracellular | GO_Intercell | Yes | Yes | |||
| intracellular | intracellular | UniProt_location | Yes | Yes | |||
| intracellular | intracellular | OmniPath | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | connectomeDB2020 | Yes | Yes | Yes |
Page 1 of 5Next
Isolation & Detection Technology (1)
Sequence, Structure & Domains
Sequences
Length
334
Mass
37,106
Sequence
MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPPTMSSGTAQPRATATTLILCCLLIMCLLICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSDSYQIAKRPLSGGHVTRVTLPIIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=RAET1G1; IsoId=Q6H3X3-1; Sequence=Displayed; Name=2; Synonyms=RAET1G2; IsoId=Q6H3X3-2; Sequence=VSP_051621, VSP_051622; Name=3; Synonyms=RAET1G3; IsoId=Q6H3X3-3; Sequence=VSP_059264, VSP_051622
Alternative Sequence
118..154; Missing (in isoform 3); 211..213; APP -> GTV (in isoform 2); 214..334; Missing (in isoform 2 and isoform 3)
Domain & Motif Annotations
Region
29..117; MHC class I alpha-1 like; 118..210; MHC class I alpha-2 like
Protein Families
MHC class I family
Sequence Similarities
Belongs to the MHC class I family.
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No related sentences available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |