Protein detail

ULBP5

UL-16 binding protein 5 (Retinoic acid early transcript 1G protein)

Entry name ULBP5	UniProt ID Q6H3X3	EVMP confidence score 0.38
Supporting publications (n) 4	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

UL-16 binding protein 5 (Retinoic acid early transcript 1G protein)

Protein Function

Predicted secreted proteins

Transmembrane

224..243; Helical

Transmembrane Count

Ensembl

ENSG00000203722

Entrez Gene Symbol

RAET1G

Supporting publications (n)

EVMP confidence score

0.38

Function & Pathway8

Protein Function

Predicted secreted proteins

Cellular Component (6)

Molecular Function (2)

Biological Process (3)

KEGG

hsa04650 Natural killer cell mediated cytotoxicity

Reactome (2)

Canonical Pathways (3)

M103 Pid s1p s1p1 pathway
M55 Pid s1p s1p3 pathway
M72 Pid nectin pathway

Mediation Categories (3)

Fusion and delivery mediationImmune mediationMetabolism mediation

Relations & Evidence44

Ligand-Receptor Signaling (43)

43 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_surface_ligand	cell_surface_ligand	CellChatDB	Yes	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	CellPhoneDB	Yes	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	Yes	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	Yes	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	Yes	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	Yes	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	Yes	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	Yes	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	Yes	Yes	No
transmembrane	transmembrane	CellPhoneDB	No	No	Yes	Yes	No

Page 2 of 5Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometryWestern blottingR SequencingFlow cytometryMORPHELISA	9	38225453 26801919 27723984 38490958 40098346 38698420 30760538 40091455 38612515

Sequence, Structure & Domains8

Sequences

Length

334

Mass

37,106

Sequence

MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLTLQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPPTMSSGTAQPRATATTLILCCLLIMCLLICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSDSYQIAKRPLSGGHVTRVTLPIIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=RAET1G1; IsoId=Q6H3X3-1; Sequence=Displayed; Name=2; Synonyms=RAET1G2; IsoId=Q6H3X3-2; Sequence=VSP_051621, VSP_051622; Name=3; Synonyms=RAET1G3; IsoId=Q6H3X3-3; Sequence=VSP_059264, VSP_051622

Alternative Sequence

118..154; Missing (in isoform 3); 211..213; APP -> GTV (in isoform 2); 214..334; Missing (in isoform 2 and isoform 3)

Domain & Motif Annotations

Region

29..117; MHC class I alpha-1 like; 118..210; MHC class I alpha-2 like

Protein Families

MHC class I family

Sequence Similarities

Belongs to the MHC class I family.

Supporting Publications4

PMID	Title	Abstract
33592500	A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia.	No abstract available
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available