Protein detail
LIRA6
Leukocyte immunoglobulin-like receptor subfamily A member 6 (Immunoglobulin-like transcript 8) (ILT-8) (Leukocyte Ig-like receptor)
Entry name LIRA6 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information7
Protein Names
Leukocyte immunoglobulin-like receptor subfamily A member 6 (Immunoglobulin-like transcript 8) (ILT-8) (Leukocyte Ig-like receptor)
Transmembrane
448..468; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization1
Cell SpecificEarly spermatids
Function & Pathway5
Cellular Component
Biological Process (3)
Reactome (2)
Mediation Categories
Immune mediation
Relations & Evidence26
Ligand-Receptor Signaling (24)
24 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Flow cytometry | 1 | 39363010 |
Sequence, Structure & Domains12
Sequences
Length
481
Mass
52,399
Sequence
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVENLIRMGMAGLVLVFLGILLFEAQHSQRNPQDAAGR
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6PI73-1; Sequence=Displayed; Name=2; IsoId=Q6PI73-2; Sequence=VSP_038149, VSP_038150
Alternative Sequence
192..193; WR -> RV (in isoform 2); 194..481; Missing (in isoform 2)
3D Structural Models
Turn
90..92
Helix
167..170; 288..290; 388..390
Beta Strand
30..35; 37..39; 45..50; 57..62; 80..87; 94..102; 116..121; 125..130; 132..135; 140..145; 147..150; 152..158; 176..183; 192..199; 206..208; 214..219; 226..231; 233..235; 240..249; 252..258; 265..268; 272..275; 277..285; 292..299; 316..321; 326..331; 333..336; 341..349; 352..358; 366..369; 374..383; 392..399; 401..403; 406..408; 414..419
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Compositional Bias
59..70; Basic and acidic residues
Domain (FT)
225..314; Ig-like C2-type 1; 323..408; Ig-like C2-type 2
Region
59..78; Disordered; 419..439; Disordered
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 27487081 | Comparative Proteomic Analysis of Extracellular Vesicles Isolated by Acoustic Trapping or Differential Centrifugation. | No abstract available |
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No abstract available |