Protein detail

LIRA6

Leukocyte immunoglobulin-like receptor subfamily A member 6 (Immunoglobulin-like transcript 8) (ILT-8) (Leukocyte Ig-like receptor)

Entry name LIRA6	UniProt ID Q6PI73	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information7

Protein Names

Leukocyte immunoglobulin-like receptor subfamily A member 6 (Immunoglobulin-like transcript 8) (ILT-8) (Leukocyte Ig-like receptor)

Transmembrane

448..468; Helical

Transmembrane Count

Ensembl

ENSG00000244482

Entrez Gene Symbol

LILRA6

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Cell SpecificEarly spermatids

Function & Pathway5

Cellular Component

GO:0005886 plasma membrane

Biological Process (3)

KEGG (2)

Reactome (2)

Mediation Categories

Immune mediation

Relations & Evidence26

Ligand-Receptor Signaling (24)

24 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
immunoglobulin_like	receptor	HGNC	No	Yes	No	Yes	No
activating_leukocyte_ig_like	receptor	HGNC	No	Yes	No	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No

Page 3 of 3Previous

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	APOE LILRA6	P02649 Q6PI73	2:2	PDB	PDB:8grx

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Flow cytometry	1	39363010

Sequence, Structure & Domains12

Sequences

Length

481

Mass

52,399

Sequence

MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVENLIRMGMAGLVLVFLGILLFEAQHSQRNPQDAAGR

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q6PI73-1; Sequence=Displayed; Name=2; IsoId=Q6PI73-2; Sequence=VSP_038149, VSP_038150

Alternative Sequence

192..193; WR -> RV (in isoform 2); 194..481; Missing (in isoform 2)

3D Structural Models

Turn

90..92

Helix

167..170; 288..290; 388..390

Beta Strand

30..35; 37..39; 45..50; 57..62; 80..87; 94..102; 116..121; 125..130; 132..135; 140..145; 147..150; 152..158; 176..183; 192..199; 206..208; 214..219; 226..231; 233..235; 240..249; 252..258; 265..268; 272..275; 277..285; 292..299; 316..321; 326..331; 333..336; 341..349; 352..358; 366..369; 374..383; 392..399; 401..403; 406..408; 414..419

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Compositional Bias

59..70; Basic and acidic residues

Domain (FT)

225..314; Ig-like C2-type 1; 323..408; Ig-like C2-type 2

Region

59..78; Disordered; 419..439; Disordered

Supporting Publications2

PMID	Title	Abstract
27487081	Comparative Proteomic Analysis of Extracellular Vesicles Isolated by Acoustic Trapping or Differential Centrifugation.	No abstract available
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available