Protein detail
CCBE1
Collagen and calcium-binding EGF domain-containing protein 1 (Full of fluid protein homolog)
Entry name CCBE1 | UniProt ID | EVMP score 0.38 |
Frequency 2 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Collagen and calcium-binding EGF domain-containing protein 1 (Full of fluid protein homolog)
Protein Class
Disease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins
Protein Function
- Disease related genes
- Predicted secreted proteins
- Human disease related genes:Congenital malformations:Other congenital malformations
Ensembl
Entrez Gene Symbol
Gene Synonym
FLJ30681KIAA1983
Gene Description
Collagen and calcium binding EGF domains 1
Chromosome
18
Position
59430939-59697662
Frequency
2
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificstomach 1Cell SpecificEsophageal apical cells
Function & Pathway
Protein Function
- Disease related genes
- Predicted secreted proteins
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component
Molecular Function
Biological Process
Mediation Categories
Metabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellTalkDB | No | Yes | Yes | No | No |
| receptor | receptor | OmniPath | No | Yes | Yes | No | No |
| ecm | ecm | MatrixDB | Yes | No | Yes | No | No |
| ecm | ecm | CellCellInteractions | Yes | No | Yes | No | No |
| ecm | ecm | OmniPath | Yes | No | Yes | No | No |
| extracellular | extracellular | OmniPath | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | No | No |
| secreted | secreted | UniProt_location | No | No | Yes | No | No |
Page 1 of 2Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains
Sequences
Length
406
Mass
44,103
Sequence
MVPPPPSRGGAARGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESKIATTKYPCLKSSGELTTCYRKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYDRERHRKREKPYCLDIDECASSNGTLCAHICINTLGSYRCECREGYIREDDGKTCTRGDKYPNDTGHEKSENMVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q6UXH8-1; Sequence=Displayed; Name=2; IsoId=Q6UXH8-2; Sequence=VSP_023470, VSP_023471; Name=3; IsoId=Q6UXH8-3; Sequence=VSP_023469
Alternative Sequence
1..271; Missing (in isoform 2); 1..191; Missing (in isoform 3); 272..305; MPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPV -> MQLTWASISLVTRCWPQTPTFQDLLACLGARALP (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
270..279; Pro residues; 281..292; Low complexity; 386..406; Basic and acidic residues
Domain (FT)
134..175; EGF-like; calcium-binding; 245..290; Collagen-like 1; 300..333; Collagen-like 2
Region
244..335; Disordered; 360..406; Disordered
Protein Families
CCBE1 family
Sequence Similarities
Belongs to the CCBE1 family.