Protein detail
CCBE1
Collagen and calcium-binding EGF domain-containing protein 1 (Full of fluid protein homolog)
Entry name CCBE1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Collagen and calcium-binding EGF domain-containing protein 1 (Full of fluid protein homolog)
Protein Class (4)
Disease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins
Protein Function (3)
- Disease related genes
- Predicted secreted proteins
- Human disease related genes:Congenital malformations:Other congenital malformations
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ30681KIAA1983
Gene Description
Collagen and calcium binding EGF domains 1
Chromosome
18
Position
59430939-59697662
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization3
Tissue Specificstomach 1Cell SpecificEsophageal apical cells
Function & Pathway5
Protein Function (3)
- Disease related genes
- Predicted secreted proteins
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component (3)
Molecular Function (4)
Biological Process (3)
Mediation Categories (2)
Metabolism mediationReceptor-signaling mediation
Relations & Evidence16
Ligand-Receptor Signaling (15)
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | HPA_secretome | No | No | Yes | No | No |
| secreted | secreted | Matrisome | No | No | Yes | No | No |
| secreted | secreted | OmniPath | No | No | Yes | No | No |
| ligand | ligand | Matrisome | Yes | No | Yes | No | No |
| ligand | ligand | OmniPath | Yes | No | Yes | No | No |
Page 2 of 2Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains10
Sequences
Length
406
Mass
44,103
Sequence
MVPPPPSRGGAARGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESKIATTKYPCLKSSGELTTCYRKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYDRERHRKREKPYCLDIDECASSNGTLCAHICINTLGSYRCECREGYIREDDGKTCTRGDKYPNDTGHEKSENMVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q6UXH8-1; Sequence=Displayed; Name=2; IsoId=Q6UXH8-2; Sequence=VSP_023470, VSP_023471; Name=3; IsoId=Q6UXH8-3; Sequence=VSP_023469
Alternative Sequence
1..271; Missing (in isoform 2); 1..191; Missing (in isoform 3); 272..305; MPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPV -> MQLTWASISLVTRCWPQTPTFQDLLACLGARALP (in isoform 2)
Domain & Motif Annotations
Compositional Bias
270..279; Pro residues; 281..292; Low complexity; 386..406; Basic and acidic residues
Domain (FT)
134..175; EGF-like; calcium-binding; 245..290; Collagen-like 1; 300..333; Collagen-like 2
Region
244..335; Disordered; 360..406; Disordered
Protein Families
CCBE1 family
Sequence Similarities
Belongs to the CCBE1 family.
Clinical Relevance2
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 20570673 | Exosomes from human lymphoblastoid B cells express enzymatically active CD38 that is associated with signaling complexes containing CD81, Hsc-70 and Lyn. | No abstract available |
| 36359760 | Extracellular Vesicles Isolated from Plasma of Multiple Myeloma Patients Treated with Daratumumab Express CD38, PD-L1, and the Complement Inhibitory Proteins CD55 and CD59. | No abstract available |