Protein detail

RAB43

Ras-related protein Rab-43 (Ras-related protein Rab-41) (EC 3.6.5.2)

Entry name RAB43	UniProt ID Q86YS6	EVMP confidence score 0.50
Supporting publications (n) 4	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Ras-related protein Rab-43 (Ras-related protein Rab-41) (EC 3.6.5.2)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000172780

Entrez Gene Symbol

RAB43

Gene Synonym (3)

ISY1RAB11BRAB41

Gene Description

RAB43, member RAS oncogene family

Chromosome

Position

129087569-129122801

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization5

Tissue SpecificbrainCell SpecificDistal convoluted tubule cellsSingle-Nuclei Brain Specificcommitted oligodendrocyte precursorBlood Cell Specificnon-classical monocyte

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (6)

Molecular Function (3)

Biological Process (3)

Reactome (6)

Mediation Categories (2)

Fusion and delivery mediationMetabolism mediation

Relations & Evidence25

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (19)

19 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
AQR BCAS2 BUD31 CACTIN CCDC12 CDC40 CRNKL1 CWC15 CWF19L2 DHX35 DHX8 ESS2 GPATCH1 ISY1 PLRG1 PPIE RAB43 RBM22 SLU7 SNW1 SYF2 USB1 XAB2 ZNF830	O43660 O60306 O60508 O75934 O95391 O95926 P41223 Q13573 Q14562 Q2TBE0 Q86YS6 Q8WUD4 Q8WUQ7 Q96DF8 Q96NB3 Q9BQ65 Q9BRR8 Q9BZJ0 Q9H5Z1 Q9HCS7 Q9NW64 Q9P013 Q9ULR0 Q9UNP9	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
AQR BCAS2 BUD31 CCDC12 CDC40 CRNKL1 CWC15 DHX35 DHX8 ISY1 PLRG1 PPIE RAB43 RBM22 SF3A2 SNW1 SYF2 XAB2	O43660 O60306 O60508 O75934 O95926 P41223 Q13573 Q14562 Q15428 Q86YS6 Q8WUD4 Q9BZJ0 Q9H5Z1 Q9HCS7 Q9NW64 Q9P013 Q9ULR0 Q9UNP9	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
AQR BCAS2 BUD31 CCDC12 CDC40 CRNKL1 CWC15 DHX8 ISY1 PLRG1 PPIE PRPF19 RAB43 RBM22 SNW1 SYF2 XAB2	O43660 O60306 O60508 O75934 O95926 P41223 Q13573 Q14562 Q86YS6 Q8WUD4 Q9BZJ0 Q9HCS7 Q9NW64 Q9P013 Q9ULR0 Q9UMS4 Q9UNP9	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
AQR BCAS2 C1orf52 CACTIN CCDC12 CRNKL1 DHX35 DHX8 GPATCH1 ISY1 PLRG1 PPIE RAB43 SLU7 WDR83 XAB2 ZNF830	O43660 O60306 O75934 O95391 Q14562 Q86YS6 Q8N6N3 Q8WUD4 Q8WUQ7 Q96NB3 Q9BRR8 Q9BRX9 Q9BZJ0 Q9H5Z1 Q9HCS7 Q9ULR0 Q9UNP9	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
CDC5L EFTUD2 PLRG1 PRPF19 PRPF39 RAB43 SF3A1 SF3A2 SF3A3 SF3B1 SF3B2 SF3B3 SNRPA1 SNW1 SRRM2	O43660 O75533 P09661 Q12874 Q13435 Q13573 Q15029 Q15393 Q15428 Q15459 Q86UA1 Q86YS6 Q99459 Q9UMS4 Q9UQ35	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9818
CDC5L CRNKL1 PLRG1 PNN PRPF19 PRPF6 RAB43 SNRNP200 SNRPA1 SNW1 SRRM2 SYF2 XAB2 YTHDC2	O43660 O75643 O94906 O95926 P09661 Q13573 Q86YS6 Q99459 Q9BZJ0 Q9H307 Q9H6S0 Q9HCS7 Q9UMS4 Q9UQ35	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3713
CDC5L EFTUD2 LYPLAL1 NCOA3 PLRG1 PRPF19 PRPF8 RAB43 SF3A2 SNRPA1 SNW1 SRRM2 UBC YTHDC2	O43660 P09661 P0CG48 Q13573 Q15029 Q15428 Q5VWZ2 Q6P2Q9 Q86YS6 Q99459 Q9H6S0 Q9UMS4 Q9UQ35 Q9Y6Q9	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7888
AQR BCAS2 BUD31 C1orf52 CACTIN CCDC12 CDC40 CRNKL1 CWC15 CWF19L2 DHX8 ESS2 FAM32A ISY1 PPIE RAB43 RBM22 SLU7 SNW1 STEEP1 SYF2 TSSC4 XAB2 ZNF830	O60306 O60508 O75934 O95391 O95926 P41223 Q13573 Q14562 Q2TBE0 Q86YS6 Q8N6N3 Q8WUD4 Q8WUQ7 Q96DF8 Q96NB3 Q9BZJ0 Q9H5V9 Q9HCS7 Q9NW64 Q9P013 Q9ULR0 Q9UNP9 Q9Y421 Q9Y5U2	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
AQR BCAS2 BUD31 CCDC12 CDC40 CDC5L CRNKL1 CWC15 DHX8 ISY1 PPIE PRPF19 RAB43 RBM22 SNW1 SYF2 XAB2	O60306 O60508 O75934 O95926 P41223 Q13573 Q14562 Q86YS6 Q8WUD4 Q99459 Q9BZJ0 Q9HCS7 Q9NW64 Q9P013 Q9ULR0 Q9UMS4 Q9UNP9	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
AQR C1orf52 CCDC12 CRNKL1 DHX8 PPIE RAB43 SLU7 XAB2 ZNF830	O60306 O95391 Q14562 Q86YS6 Q8N6N3 Q8WUD4 Q96NB3 Q9BZJ0 Q9HCS7 Q9UNP9	0:0:0:0:0:0:0:0:0:0	hu.MAP

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion Chromatography	Mass spectrometry	8	33204424 38168906 34817906 27894104 29045505 30950185 39558134 30408591

Sequence, Structure & Domains13

Sequences

Length

212

Mass

23,339

Sequence

MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q86YS6-1; Sequence=Displayed; Name=2; Synonyms=ISY1-RAB43; IsoId=Q9ULR0-1; Sequence=External; Name=3; IsoId=Q86YS6-2; Sequence=VSP_054030, VSP_054031

Alternative Sequence

130..155; GNKSDLSELREVSLAEAQSLAEHYDI -> EMQSCYVAQADLELLASSNPPASTSK (in isoform 3); 156..212; Missing (in isoform 3)

3D Structural Models

Turn

163..166

Helix

31..40; 78..80; 81..88; 103..107; 109..119; 136..138; 143..152; 169..183

Beta Strand

17..25; 55..62; 65..72; 92..99; 125..131; 156..160

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Domain (CC)

Switch I, switch II and the interswitch regions are characteristic of Rab GTPases and mediate the interactions with Rab downstream effectors. The switch regions undergo conformational changes upon nucleotide binding which drive interaction with specific sets of effector proteins, with most effectors only binding to GTP-bound Rab.

Region

45..53; Switch-I; 76..92; Switch-II

Protein Families (2)

Small GTPase superfamily
Rab family

Sequence Similarities

Belongs to the small GTPase superfamily. Rab family.

Clinical Relevance1

Antibody (2)

HPA046840 HPA060085

Supporting Publications4

PMID	Title	Abstract
30865381	Surfaceome of Exosomes Secreted from the Colorectal Cancer Cell Line SW480: Peripheral and Integral Membrane Proteins Analyzed by Proteolysis and TX114.	No abstract available
31753726	Serum extracellular vesicles contain SPARC and LRG1 as biomarkers of colon cancer and differ by tumour primary location.	No abstract available
36028467	Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment.	No abstract available
41167904	Accessing the proteome of extracellular vesicles via rapid acoustic isolation of a minute human blood plasma sample.	No abstract available