Protein detail

RAB43

Ras-related protein Rab-43 (Ras-related protein Rab-41) (EC 3.6.5.2)

Entry name RAB43	UniProt ID Q86YS6	EVMP confidence score 0.50
Supporting publications (n) 4	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Ras-related protein Rab-43 (Ras-related protein Rab-41) (EC 3.6.5.2)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000172780

Entrez Gene Symbol

RAB43

Gene Synonym (3)

ISY1RAB11BRAB41

Gene Description

RAB43, member RAS oncogene family

Chromosome

Position

129087569-129122801

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization5

Tissue SpecificbrainCell SpecificDistal convoluted tubule cellsSingle-Nuclei Brain Specificcommitted oligodendrocyte precursorBlood Cell Specificnon-classical monocyte

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (6)

Molecular Function (3)

Biological Process (3)

Reactome (6)

Mediation Categories (2)

Fusion and delivery mediationMetabolism mediation

Relations & Evidence25

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (19)

19 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
AQR CACTIN CCDC12 CRNKL1 DHX35 DHX8 GPATCH1 PPIE RAB43 SLU7 XAB2 ZNF830	O60306 O95391 Q14562 Q86YS6 Q8WUD4 Q8WUQ7 Q96NB3 Q9BRR8 Q9BZJ0 Q9H5Z1 Q9HCS7 Q9UNP9	0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
CACTIN CCDC12 DHX8 FAM32A NUDCD1 RAB43 SDE2 SLU7 STEEP1	O95391 Q14562 Q6IQ49 Q86YS6 Q8WUD4 Q8WUQ7 Q96RS6 Q9H5V9 Q9Y421	0:0:0:0:0:0:0:0:0	hu.MAP2
C1orf52 CACTIN CRNKL1 DHX8 NUDCD1 RAB43 SLU7 STEEP1 ZNF830	O95391 Q14562 Q86YS6 Q8N6N3 Q8WUQ7 Q96NB3 Q96RS6 Q9BZJ0 Q9H5V9	0:0:0:0:0:0:0:0:0	hu.MAP
CACTIN DHX8 NUDCD1 RAB43 SLU7 STEEP1	O95391 Q14562 Q86YS6 Q8WUQ7 Q96RS6 Q9H5V9	0:0:0:0:0:0	hu.MAP2
DHX34 RAB43 SDE2	Q14147 Q6IQ49 Q86YS6	0:0:0	hu.MAP
C1orf52 DHX34 RAB43 SDE2	Q14147 Q6IQ49 Q86YS6 Q8N6N3	0:0:0:0	hu.MAP
RAB43 SDE2	Q6IQ49 Q86YS6	0:0	hu.MAP
C1orf52 RAB43 SDE2	Q6IQ49 Q86YS6 Q8N6N3	0:0:0	hu.MAP
RAB43	Q86YS6	2	PDB	PDB:2hup

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion Chromatography	Mass spectrometry	8	33204424 38168906 34817906 27894104 29045505 30950185 39558134 30408591

Sequence, Structure & Domains13

Sequences

Length

212

Mass

23,339

Sequence

MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q86YS6-1; Sequence=Displayed; Name=2; Synonyms=ISY1-RAB43; IsoId=Q9ULR0-1; Sequence=External; Name=3; IsoId=Q86YS6-2; Sequence=VSP_054030, VSP_054031

Alternative Sequence

130..155; GNKSDLSELREVSLAEAQSLAEHYDI -> EMQSCYVAQADLELLASSNPPASTSK (in isoform 3); 156..212; Missing (in isoform 3)

3D Structural Models

Turn

163..166

Helix

31..40; 78..80; 81..88; 103..107; 109..119; 136..138; 143..152; 169..183

Beta Strand

17..25; 55..62; 65..72; 92..99; 125..131; 156..160

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Domain (CC)

Switch I, switch II and the interswitch regions are characteristic of Rab GTPases and mediate the interactions with Rab downstream effectors. The switch regions undergo conformational changes upon nucleotide binding which drive interaction with specific sets of effector proteins, with most effectors only binding to GTP-bound Rab.

Region

45..53; Switch-I; 76..92; Switch-II

Protein Families (2)

Small GTPase superfamily
Rab family

Sequence Similarities

Belongs to the small GTPase superfamily. Rab family.

Clinical Relevance1

Antibody (2)

HPA046840 HPA060085

Supporting Publications4

PMID	Title	Abstract
30865381	Surfaceome of Exosomes Secreted from the Colorectal Cancer Cell Line SW480: Peripheral and Integral Membrane Proteins Analyzed by Proteolysis and TX114.	No abstract available
31753726	Serum extracellular vesicles contain SPARC and LRG1 as biomarkers of colon cancer and differ by tumour primary location.	No abstract available
36028467	Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment.	No abstract available
41167904	Accessing the proteome of extracellular vesicles via rapid acoustic isolation of a minute human blood plasma sample.	No abstract available