Protein detail
TRML1
Trem-like transcript 1 protein (TLT-1) (Triggering receptor expressed on myeloid cells-like protein 1)
Entry name TRML1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 7 | Transmembrane count 1 | Protein classification Plasma proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
Trem-like transcript 1 protein (TLT-1) (Triggering receptor expressed on myeloid cells-like protein 1)
Protein Class (2)
Plasma proteinsPredicted membrane proteins
Transmembrane
163..183; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
dJ238O23.3TLT1
Gene Description
Triggering receptor expressed on myeloid cells like 1
Chromosome
6
Position
41149337-41154347
Supporting publications (n)
7
EVMP confidence score
0.50
Fluorescence & Localization7
Tissue SpecificplacentaCell SpecificEpicardial cellsSingle-Nuclei Brain Specifichippocampal CA1-3Blood Cell SpecificgdT-cellBlood Lineage SpecificNK-cellsSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway5
Cellular Component (7)
Molecular Function (2)
Biological Process (3)
Reactome (2)
Mediation Categories (2)
Immune mediationReceptor-signaling mediation
Relations & Evidence34
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 17 | 3320442439766158363985643778691839940923394090153720509834817906289865852789410430950185383215353955813439569406304085913208974329148239 |
Sequence, Structure & Domains13
Sequences
Length
311
Mass
32,679
Sequence
MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q86YW5-1; Sequence=Displayed; Name=2; Synonyms=TLT1sv; IsoId=Q86YW5-2; Sequence=VSP_021125, VSP_021126; Name=3; IsoId=Q86YW5-3; Sequence=VSP_021124
Alternative Sequence
15..125; Missing (in isoform 3); 190..199; GNRLGVCGRF -> ESLLSGPPRQ (in isoform 2); 200..311; Missing (in isoform 2)
3D Structural Models
Turn
74..76; 139..142
Helix
42..44; 96..98; 135..137
Beta Strand
24..28; 34..39; 47..55; 58..64; 70..73; 77..83; 86..91; 100..108; 111..122
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
239..249; Polar residues
Motif
279..284; ITIM
Domain (FT)
16..121; Ig-like V-type
Region
229..263; Disordered; 287..311; Disordered
Supporting Publications7
| PMID | Title | Abstract |
|---|---|---|
| 24670152 | Quantitative proteomics of extracellular vesicles released from human monocyte-derived macrophages upon β-glucan stimulation. | No abstract available |
| 29603567 | Involvement of serum-derived exosomes of elderly patients with bone loss in failure of bone remodeling via alteration of exosomal bone-related proteins. | No abstract available |
| 30865381 | Surfaceome of Exosomes Secreted from the Colorectal Cancer Cell Line SW480: Peripheral and Integral Membrane Proteins Analyzed by Proteolysis and TX114. | No abstract available |
| 31753726 | Serum extracellular vesicles contain SPARC and LRG1 as biomarkers of colon cancer and differ by tumour primary location. | No abstract available |
| 32938681 | Annexin A1-dependent tethering promotes extracellular vesicle aggregation revealed with single-extracellular vesicle analysis. | No abstract available |
| 36028467 | Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment. | No abstract available |
| 41167904 | Accessing the proteome of extracellular vesicles via rapid acoustic isolation of a minute human blood plasma sample. | No abstract available |