Protein detail
OSCAR
Osteoclast-associated immunoglobulin-like receptor (Osteoclast-associated receptor) (hOSCAR) (Polymeric immunoglobulin receptor 3) (PIgR-3) (PIgR3) (Poly-Ig receptor 3)
Protein symbol OSCAR | UniProt ID | EVMP score 0.50 |
Frequency 2 | Transmembrane count | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Osteoclast-associated immunoglobulin-like receptor (Osteoclast-associated receptor) (hOSCAR) (Polymeric immunoglobulin receptor 3) (PIgR-3) (PIgR3) (Poly-Ig receptor 3)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Frequency
2
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificCardiomyocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
- GO:0002486 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent
- GO:0002476 antigen processing and presentation of endogenous peptide antigen via MHC class Ib
- GO:0002484 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway
Reactome
Mediation Categories
Immune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
21 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | Yes | No | No |
| extracellular | extracellular | OmniPath | No | No | Yes | No | No |
| intracellular | intracellular | LOCATE | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | Yes | No | No |
Page 1 of 3Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
282
Mass
30,481
Sequence
MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=OSCAR-S1; IsoId=Q8IYS5-1; Sequence=Displayed; Name=2; Synonyms=OSCAR-M1; IsoId=Q8IYS5-2; Sequence=VSP_029355; Name=3; Synonyms=OSCAR-M2; IsoId=Q8IYS5-3; Sequence=VSP_029353, VSP_029355; Name=4; Synonyms=OSCAR-S2; IsoId=Q8IYS5-4; Sequence=VSP_029352; Name=5; IsoId=Q8IYS5-5; Sequence=VSP_029354; Name=7; IsoId=Q8IYS5-7; Sequence=VSP_029353; Name=6; Synonyms=OSCAR-M3; IsoId=Q8IYS5-6; Sequence=VSP_029352, VSP_029355
Alternative Sequence
13..25; WPLCHTDITPSVP -> FP (in isoform 4 and isoform 6); 24; V -> VAIIV (in isoform 3 and isoform 7); 129..134; Missing (in isoform 5); 219..282; GEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV -> DSGSSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQNRAPAGIRP (in isoform 2, isoform 3 and isoform 6)
3D Structural Models
Turn
186..188
Helix
92..94
Beta Strand
34..39; 41..43; 49..65; 73..87; 96..103; 119..123; 125..127; 131..134; 146..151; 158..163; 166..174; 176..184; 191..198; 200..203; 213..215
3D Structure
X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
273..282; Pro residues
Domain (FT)
22..116; Ig-like 1; 126..219; Ig-like 2
Region
221..282; Disordered
Protein Families
Leukocyte receptor complex/polymeric immunoglobulin receptor (PIR/LRC) family
Sequence Similarities
Belongs to the leukocyte receptor complex/polymeric immunoglobulin receptor (PIR/LRC) family.