Protein detail

TOR2X

Prosalusin (Torsin family 2 member A) (Torsin-2A) [Cleaved into: Salusin-alpha; Salusin-beta]

Entry name TOR2X	UniProt ID Q8N2E6	EVMP confidence score 0.50
Supporting publications (n) 6	Transmembrane count	Protein classification Predicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Prosalusin (Torsin family 2 member A) (Torsin-2A) [Cleaved into: Salusin-alpha; Salusin-beta]

Protein Class

Predicted secreted proteins

Protein Function

Predicted secreted proteins

Ensembl

ENSG00000160404

Entrez Gene Symbol

TOR2A

Gene Synonym (2)

FLJ14771TORP1

Gene Description

Torsin family 2 member A

Chromosome

Position

127731524-127735313

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Tissue Specificskeletal muscleCell SpecificAdrenal cortex cellsSingle-Nuclei Brain Specificastrocyte

Function & Pathway5

Protein Function

Predicted secreted proteins

Cellular Component (3)

Molecular Function (4)

Biological Process (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence40

Ligand-Receptor Signaling (30)

30 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	GO_Intercell	No	No	Yes	No	No
intracellular	intracellular	UniProt_location	No	No	Yes	No	No
intracellular	intracellular	UniProt_location	No	No	Yes	No	No
intracellular	intracellular	OmniPath	No	No	Yes	No	No
intracellular	intracellular	OmniPath	No	No	Yes	No	No
secreted	secreted	UniProt_keyword	No	No	Yes	No	No
secreted	secreted	UniProt_keyword	No	No	Yes	No	No
secreted	secreted	UniProt_location	No	No	Yes	No	No
secreted	secreted	UniProt_location	No	No	Yes	No	No
secreted	secreted	HPA_secretome	No	No	Yes	No	No

Page 2 of 3Previous Next

Protein Complex Composition (9)

9 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster128	DNAJC3 MANBA TOR1A TOR1B TOR2A TOR3A TOR4A	O00462 O14656 O14657 Q13217 Q8N2E6 Q9H497 Q9NXH8	1:1:1:1:1:1:1	Compleat	Compleat:HC3203	22036573
	CENPB TOR1A TOR2A ZNF707	O14656 P07199 Q5JU69 Q96C28	0:0:0:0	hu.MAP2
	CENPB TOR1A TOR2A ZNF707 ZNF747	O14656 P07199 Q5JU69 Q96C28 Q9BV97	0:0:0:0:0	hu.MAP2
	CENPB TOR1A TOR2A ZNF707	O14656 P07199 Q8N2E6 Q96C28	0:0:0:0	hu.MAP2
	CENPB TOR1A TOR2A ZNF707 ZNF747	O14656 P07199 Q8N2E6 Q96C28 Q9BV97	0:0:0:0:0	hu.MAP2
	TOR1A TOR2A	O14656 Q5JU69	0:0	hu.MAP
	TOR1A TOR2A	O14656 Q8N2E6	0:0	hu.MAP
	TOR2A ZNF707	Q5JU69 Q96C28	0:0	hu.MAP2
	TOR2A ZNF707	Q8N2E6 Q96C28	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometry	5	32795414 33035814 30646616 38321535 32089743

Sequence, Structure & Domains8

Sequences

Length

242

Mass

26,262

Sequence

MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWLLKLGHHGRAPPRRSGALPPAPAAPRPALRAQRAGPAGPGAKG

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=4; IsoId=Q8N2E6-1; Sequence=Displayed; Name=1; IsoId=Q5JU69-1; Sequence=External; Name=2; IsoId=Q5JU69-2; Sequence=External; Name=3; IsoId=Q5JU69-5; Sequence=External

Domain & Motif Annotations

Compositional Bias

225..235; Low complexity

Region

210..242; Disordered

Protein Families (2)

ClpA/ClpB family
Torsin subfamily

Sequence Similarities

Belongs to the ClpA/ClpB family. Torsin subfamily.

Clinical Relevance1

Antibody

HPA071229

Supporting Publications6

PMID	Title	Abstract
36573687	Proteomic and phosphoproteomic landscape of salivary extracellular vesicles to assess OSCC therapeutical outcomes.	No abstract available
38037300	Proteomic profiling of paired human liver homogenate and tissue derived extracellular vesicles.	No abstract available
38576002	Therapy-induced senescent tumor cell-derived extracellular vesicles promote colorectal cancer progression through SERPINE1-mediated NF-κB p65 nuclear translocation.	No abstract available
38871114	Proteomic analysis of endothelial cells and extracellular vesicles in response to indoxyl sulfate: Mechanisms of endothelial dysfunction in chronic kidney disease.	No abstract available
39535266	Divergent Proteomic Profiles and Uptake Mechanisms of Exosomes Derived from Human Dental Pulp Stem Cells, Endothelial Cells, and Fibroblasts.	No abstract available
39996590	Surface Double Dendritic Magnetic Microfibrils for Rapid Isolation and Proteomic Profiling of Extracellular Vesicles from Microliters of Biofluids.	No abstract available