Protein detail
TOR2X
Prosalusin (Torsin family 2 member A) (Torsin-2A) [Cleaved into: Salusin-alpha; Salusin-beta]
Entry name TOR2X | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 6 | Transmembrane count | Protein classification Predicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Prosalusin (Torsin family 2 member A) (Torsin-2A) [Cleaved into: Salusin-alpha; Salusin-beta]
Protein Class
Predicted secreted proteins
Protein Function
Predicted secreted proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ14771TORP1
Gene Description
Torsin family 2 member A
Chromosome
9
Position
127731524-127735313
Supporting publications (n)
6
EVMP confidence score
0.38
Fluorescence & Localization
Tissue Specificskeletal muscleCell SpecificAdrenal cortex cellsSingle-Nuclei Brain Specificastrocyte
Function & Pathway
Protein Function
Predicted secreted proteins
Cellular Component (3)
Molecular Function (4)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence40
Ligand-Receptor Signaling (30)
30 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | HPA_secretome | Yes | ||||
| secreted | secreted | connectomeDB2020 | Yes | ||||
| secreted | secreted | connectomeDB2020 | Yes | ||||
| secreted | secreted | OmniPath | Yes | ||||
| secreted | secreted | OmniPath | Yes | ||||
| ligand | ligand | connectomeDB2020 | Yes | Yes | |||
| ligand | ligand | connectomeDB2020 | Yes | Yes | |||
| prosalusin | ligand | OmniPath | Yes | Yes | |||
| ligand | ligand | OmniPath | Yes | Yes | |||
| ligand | ligand | OmniPath | Yes | Yes |
Page 3 of 3Previous
Protein Complex Composition (9)
9 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster128 | DNAJC3MANBATOR1ATOR1BTOR2ATOR3ATOR4A | O00462O14656O14657Q13217Q8N2E6Q9H497Q9NXH8 | 1:1:1:1:1:1:1 | Compleat | Compleat:HC3203 | 22036573 |
| CENPBTOR1ATOR2AZNF707 | O14656P07199Q5JU69Q96C28 | 0:0:0:0 | hu.MAP2 | |||
| CENPBTOR1ATOR2AZNF707ZNF747 | O14656P07199Q5JU69Q96C28Q9BV97 | 0:0:0:0:0 | hu.MAP2 | |||
| CENPBTOR1ATOR2AZNF707 | O14656P07199Q8N2E6Q96C28 | 0:0:0:0 | hu.MAP2 | |||
| CENPBTOR1ATOR2AZNF707ZNF747 | O14656P07199Q8N2E6Q96C28Q9BV97 | 0:0:0:0:0 | hu.MAP2 | |||
| TOR1ATOR2A | O14656Q5JU69 | 0:0 | hu.MAP | |||
| TOR1ATOR2A | O14656Q8N2E6 | 0:0 | hu.MAP | |||
| TOR2AZNF707 | Q5JU69Q96C28 | 0:0 | hu.MAP2 | |||
| TOR2AZNF707 | Q8N2E6Q96C28 | 0:0 | hu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
242
Mass
26,262
Sequence
MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRVHHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGSSWVVYGTNYRKAIFIFIRWLLKLGHHGRAPPRRSGALPPAPAAPRPALRAQRAGPAGPGAKG
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=4; IsoId=Q8N2E6-1; Sequence=Displayed; Name=1; IsoId=Q5JU69-1; Sequence=External; Name=2; IsoId=Q5JU69-2; Sequence=External; Name=3; IsoId=Q5JU69-5; Sequence=External
Domain & Motif Annotations
Compositional Bias
225..235; Low complexity
Region
210..242; Disordered
Protein Families (2)
- ClpA/ClpB family
- Torsin subfamily
Sequence Similarities
Belongs to the ClpA/ClpB family. Torsin subfamily.
Clinical Relevance
Antibody
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 36573687 | Proteomic and phosphoproteomic landscape of salivary extracellular vesicles to assess OSCC therapeutical outcomes. | No related sentences available |
| 38037300 | Proteomic profiling of paired human liver homogenate and tissue derived extracellular vesicles. | No related sentences available |
| 38576002 | Therapy-induced senescent tumor cell-derived extracellular vesicles promote colorectal cancer progression through SERPINE1-mediated NF-κB p65 nuclear translocation. | No related sentences available |
| 38871114 | Proteomic analysis of endothelial cells and extracellular vesicles in response to indoxyl sulfate: Mechanisms of endothelial dysfunction in chronic kidney disease. | No related sentences available |
| 39535266 | Divergent Proteomic Profiles and Uptake Mechanisms of Exosomes Derived from Human Dental Pulp Stem Cells, Endothelial Cells, and Fibroblasts. | No related sentences available |
| 39996590 | Surface Double Dendritic Magnetic Microfibrils for Rapid Isolation and Proteomic Profiling of Extracellular Vesicles from Microliters of Biofluids. | No related sentences available |