Protein detail

CLD19

Claudin-19

Entry name CLD19	UniProt ID Q8N6F1	EVMP confidence score 0.50
Supporting publications (n) 3	Transmembrane count 4	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Claudin-19

Protein Function (4)

Disease related genes
Transporters:Transporter channels and pores
Potential drug targets
Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism

Transmembrane

8..28; Helical; 82..102; Helical; 118..138; Helical; 161..181; Helical

Transmembrane Count

Ensembl

ENSG00000164007

Entrez Gene Symbol

CLDN19

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization4

Tissue SpecificbrainCell SpecificConjunctival goblet cellsBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes

Function & Pathway8

Protein Function (4)

Disease related genes
Transporters:Transporter channels and pores
Potential drug targets
Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism

Cellular Component (10)

Molecular Function (4)

Biological Process (3)

KEGG (7)

Reactome (3)

Canonical Pathways (3)

M64 Pid s1p s1p4 pathway
M120 Pid arf6 downstream pathway
M138 Pid thrombin par4 pathway

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence28

Ligand-Receptor Signaling (27)

27 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	No	No
adhesion	adhesion	OmniPath	Yes	Yes	No	No	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	No	No
tight_junction	tight_junction	GO_Intercell	Yes	Yes	No	No	No
tight_junction	tight_junction	Ramilowski_location	Yes	Yes	No	No	No
tight_junction	tight_junction	Zhong2015	Yes	Yes	No	No	No

Page 1 of 3Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry	0

Sequence, Structure & Domains8

Sequences

Length

224

Mass

23,229

Sequence

MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8N6F1-1; Sequence=Displayed; Name=2; IsoId=Q8N6F1-2; Sequence=VSP_010342; Name=3; IsoId=Q8N6F1-3; Sequence=VSP_044839

Alternative Sequence

131..224; LCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV -> MNLAQPCSWAGPQLAWPCWAAPSSAAHARSQRDPTAAHSPIGLDPLLLPESTSELRLPWPAPHPVAPLPSIQPASQHPGQGHWGIGWA (in isoform 3); 210..224; PVVKLPASAKGPLGV -> YV (in isoform 2)

Domain & Motif Annotations

Region

191..224; Disordered

Protein Families

Claudin family

Sequence Similarities

Belongs to the claudin family.

Supporting Publications3

PMID	Title	Abstract
36497150	Tumor Cell Derived Exosomal GOT1 Suppresses Tumor Cell Ferroptosis to Accelerate Pancreatic Cancer Progression by Activating Nrf2/HO-1 Axis via Upregulating CCR2 Expression.	Furthermore, when exosome-treated cells were transfected with si-GOT1 alone or co-incubated with Nrf2 activator NK-252, we found that si-GOT1 reversed the promoting effect of exosomes on Nrf2 and HO-1 expression, as well as its inhibitory effect on ferroptosis, but this effect was abrogated by NK-252. In vivo studies showed that knockdown of GOT1 expression inhibited tumor formation compared with tumor tissues formed upon exosome induction, which was mediated by promoting ferroptosis via suppressing the protein expression of GOT1, CCR2, Nrf2 and HO-1 in tumor tissues. Next, exosome-treated cells were transfected with si-GOT1 alone or together with pcDNA-CCR2, and we found that exosomes promoted CCR2 expression, promoted cell proliferation and invasion, and inhibited ferroptosis, the transfection of si-GOT1 abolished the effect of exosomes, and the transfection of pcDNA-CCR2 again reversed the effect of si-GOT1. We found that GOT1 expression was upregulated in pancreatic cancer cell-derived exosomes. When PANC-1 cells were incubated with exosomes alone or transfected together with si-GOT1, we found that exosomes enhanced cell proliferation, invasion and migration, promoted ferroptosis, and si-GOT1 reversed the effects of exosomes.
39145985	Engineered Extracellular Vesicle-Based Nanoformulations That Coordinate Neuroinflammation and Immune Homeostasis, Enhancing Parkinson's Disease Therapy.	Specifically, EVN is developed by coating CCR2-enriched mesenchymal stem cell-derived extracellular vesicles (MSC
39222826	CCL2/CCR2 axis promotes perineural invasion of salivary adenoid cystic carcinoma via ITGβ5-mediated nerve-tumor interaction.	High levels of ITGβ5 in tissues or plasma exosomes were significantly correlated with CCL2 and CCR2 expression in the tissues and associated with PNI and poor prognosis of SACC cases.