Protein detail

CNNM3

Metal transporter CNNM3 (Ancient conserved domain-containing protein 3) (Cyclin-M3)

Entry name CNNM3	UniProt ID Q8NE01	EVMP confidence score 0.63
Supporting publications (n) 8	Transmembrane count 4	Protein classification Predicted membrane proteinsTransporters

Basic Information

Protein Names

Metal transporter CNNM3 (Ancient conserved domain-containing protein 3) (Cyclin-M3)

Protein Class (2)

Predicted membrane proteinsTransporters

Protein Function

Transporters:Transporter channels and pores

Transmembrane

11..27; Helical; 193..213; Helical; 221..241; Helical; 261..281; Helical

Transmembrane Count

Ensembl

ENSG00000168763

Entrez Gene Symbol

CNNM3

Gene Synonym

ACDP3

Gene Description

Cyclin and CBS domain divalent metal cation transport mediator 3

Chromosome

Position

96816245-96835382

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization

Cell SpecificEarly spermatidsSingle-Nuclei Brain Specificependymal cellBlood Cell Specificplasmacytoid DC

Function & Pathway

Protein Function

Transporters:Transporter channels and pores

Cellular Component (2)

Molecular Function (2)

Biological Process (3)

Mediation Categories

Metabolism mediation

Relations & Evidence22

Ligand-Receptor Signaling (18)

18 records.

Category	Parent	Database	Plasma Membrane (Transmembrane)
transmembrane	transmembrane	OmniPath	Yes
plasma_membrane	plasma_membrane	UniProt_location	Yes
plasma_membrane	plasma_membrane	OmniPath	Yes
plasma_membrane_transmembrane	plasma_membrane_transmembrane	CSPA	Yes
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	Yes
cell_surface	cell_surface	Surfaceome	Yes
cell_surface	cell_surface	OmniPath	Yes
transmembrane	transmembrane_predicted	Phobius	Yes

Page 2 of 2Previous

Protein Complex Composition (3)

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CNNM3 PTP4A3	O75365 Q8NE01	2:2	PDB	PDB:5tsr
CNNM3 PTP4A2	Q12974 Q8NE01	1:1	PDB	PDB:5k25PDB:6wurPDB:5k22PDB:5k23
CNNM3	Q8NE01	2	PDB	PDB:6mn6PDB:6dfd

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Western blotting	2	33709510 37922300

Sequence, Structure & Domains

Sequences

Length

707

Mass

76,119

Sequence

MAAAVAAAGRLGWLFAALCLGNAAGEAAPGPRVLGFCLEEDGAAGAGWVRGGAARDTPDATFLLRLFGPGFANSSWSWVAPEGAGCREEAASPAGEWRALLRLRLRAEAVRPHSALLAVRVEPGGGAAEEAAPPWALGLGAAGLLALAALARGLQLSALALAPAEVQVLRESGSEAERAAARRLEPARRWAGCALGALLLLASLAQAALAVLLYRAAGQRAVPAVLGSAGLVFLVGEVVPAAVSGRWTLALAPRALGLSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARGGGDPYSDLSKGVLRCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIVDMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVNNEGEGDPFYEVLGLVTLEDVIEEIIRSEILDESEDYRDTVVKRKPASLMAPLKRKEEFSLFKVSDDEYKVTISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLKHPSVNQEVRFDESNRLATHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTVPSSVHQSPVSSLQPIRHDLQPDPGDGTHSSAYCPDYTVRALSDLQLIKVTRLQYLNALLATRAQNLPQSPENTDLQVIPGSQTRLLGEKTTTAAGSSHSRPGVPVEGSPGRNPGV

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8NE01-1; Sequence=Displayed; Name=2; IsoId=Q8NE01-2; Sequence=VSP_027082; Name=3; IsoId=Q8NE01-3; Sequence=VSP_027082, VSP_027083

Alternative Sequence

410..457; Missing (in isoform 2 and isoform 3); 694..707; GVPVEGSPGRNPGV -> SLPLLPRGRDSAAYSDSDLFGLSHLVSAVTAFVWP (in isoform 3)

3D Structural Models

Turn

302..308; 309..311; 452..454; 513..515; 571..574

Helix

314..316; 321..323; 335..342; 365..368; 379..385; 399..407; 437..445; 494..507; 509..511; 518..525; 528..530; 544..546; 587..590; 643..654

Beta Strand

318..320; 347..355; 359..364; 373..375; 392..394; 412..420; 423..425; 428..436; 531..534; 538..540; 547..549; 557..563; 566..570; 575..579; 627..634; 636..642

3D Structure

X-ray crystallography (7)

Domain & Motif Annotations

Compositional Bias

678..691; Polar residues

Domain (FT)

130..308; CNNM transmembrane; 318..379; CBS 1; 386..452; CBS 2

Region

678..707; Disordered

Protein Families

ACDP family

Sequence Similarities

Belongs to the ACDP family.

Clinical Relevance

Antibody

HPA016711

Interaction Protein (2)

ENSG00000127022ENSG00000184007

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid

Supporting Publications8

PMID	Title	Related sentences
27723984	Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection.	No related sentences available
30353492	Extracellular Vesicles Released by Glioblastoma Cells Stimulate Normal Astrocytes to Acquire a Tumor-Supportive Phenotype Via p53 and MYC Signaling Pathways.	No related sentences available
30608700	Quantitative Proteomic Analysis of Small and Large Extracellular Vesicles (EVs) Reveals Enrichment of Adhesion Proteins in Small EVs.	No related sentences available
32795414	Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers.	Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers.
38082559	Proteomic comparison between non-purified cerebrospinal fluid and cerebrospinal fluid-derived extracellular vesicles from patients with Alzheimer's, Parkinson's and Lewy body dementia.	No related sentences available
38490958	Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer.	No related sentences available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No related sentences available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No related sentences available