Protein detail
CNNM3
Metal transporter CNNM3 (Ancient conserved domain-containing protein 3) (Cyclin-M3)
Entry name CNNM3 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 8 | Transmembrane count 4 | Protein classification Predicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Metal transporter CNNM3 (Ancient conserved domain-containing protein 3) (Cyclin-M3)
Protein Class (2)
Predicted membrane proteinsTransporters
Protein Function
Transporters:Transporter channels and pores
Transmembrane
11..27; Helical; 193..213; Helical; 221..241; Helical; 261..281; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym
ACDP3
Gene Description
Cyclin and CBS domain divalent metal cation transport mediator 3
Chromosome
2
Position
96816245-96835382
Supporting publications (n)
8
EVMP confidence score
0.38
Fluorescence & Localization4
Cell SpecificEarly spermatidsSingle-Nuclei Brain Specificependymal cellBlood Cell Specificplasmacytoid DC
Function & Pathway5
Protein Function
Transporters:Transporter channels and pores
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Metabolism mediation
Relations & Evidence22
Ligand-Receptor Signaling (18)
18 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 2 of 2Previous
Protein Complex Composition (3)
Sequence, Structure & Domains14
Sequences
Length
707
Mass
76,119
Sequence
MAAAVAAAGRLGWLFAALCLGNAAGEAAPGPRVLGFCLEEDGAAGAGWVRGGAARDTPDATFLLRLFGPGFANSSWSWVAPEGAGCREEAASPAGEWRALLRLRLRAEAVRPHSALLAVRVEPGGGAAEEAAPPWALGLGAAGLLALAALARGLQLSALALAPAEVQVLRESGSEAERAAARRLEPARRWAGCALGALLLLASLAQAALAVLLYRAAGQRAVPAVLGSAGLVFLVGEVVPAAVSGRWTLALAPRALGLSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARGGGDPYSDLSKGVLRCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIVDMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVNNEGEGDPFYEVLGLVTLEDVIEEIIRSEILDESEDYRDTVVKRKPASLMAPLKRKEEFSLFKVSDDEYKVTISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLKHPSVNQEVRFDESNRLATHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTVPSSVHQSPVSSLQPIRHDLQPDPGDGTHSSAYCPDYTVRALSDLQLIKVTRLQYLNALLATRAQNLPQSPENTDLQVIPGSQTRLLGEKTTTAAGSSHSRPGVPVEGSPGRNPGV
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8NE01-1; Sequence=Displayed; Name=2; IsoId=Q8NE01-2; Sequence=VSP_027082; Name=3; IsoId=Q8NE01-3; Sequence=VSP_027082, VSP_027083
Alternative Sequence
410..457; Missing (in isoform 2 and isoform 3); 694..707; GVPVEGSPGRNPGV -> SLPLLPRGRDSAAYSDSDLFGLSHLVSAVTAFVWP (in isoform 3)
3D Structural Models
Turn
302..308; 309..311; 452..454; 513..515; 571..574
Helix
314..316; 321..323; 335..342; 365..368; 379..385; 399..407; 437..445; 494..507; 509..511; 518..525; 528..530; 544..546; 587..590; 643..654
Beta Strand
318..320; 347..355; 359..364; 373..375; 392..394; 412..420; 423..425; 428..436; 531..534; 538..540; 547..549; 557..563; 566..570; 575..579; 627..634; 636..642
3D Structure
X-ray crystallography (7)
Domain & Motif Annotations
Compositional Bias
678..691; Polar residues
Domain (FT)
130..308; CNNM transmembrane; 318..379; CBS 1; 386..452; CBS 2
Region
678..707; Disordered
Protein Families
ACDP family
Sequence Similarities
Belongs to the ACDP family.
Clinical Relevance4
Antibody
Interaction Protein (2)
ENSG00000127022ENSG00000184007
Interaction Count
2
Interaction Dataset (2)
biogrid_opencellintact_biogrid
Supporting Publications8
| PMID | Title | Abstract |
|---|---|---|
| 27723984 | Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection. | No abstract available |
| 30353492 | Extracellular Vesicles Released by Glioblastoma Cells Stimulate Normal Astrocytes to Acquire a Tumor-Supportive Phenotype Via p53 and MYC Signaling Pathways. | No abstract available |
| 30608700 | Quantitative Proteomic Analysis of Small and Large Extracellular Vesicles (EVs) Reveals Enrichment of Adhesion Proteins in Small EVs. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 38082559 | Proteomic comparison between non-purified cerebrospinal fluid and cerebrospinal fluid-derived extracellular vesicles from patients with Alzheimer's, Parkinson's and Lewy body dementia. | No abstract available |
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |