Protein detail
RAI3
Retinoic acid-induced protein 3 (G-protein coupled receptor family C group 5 member A) (Phorbol ester induced gene 1) (PEIG-1) (Retinoic acid-induced gene 1 protein) (RAIG-1)
Entry name RAI3 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Retinoic acid-induced protein 3 (G-protein coupled receptor family C group 5 member A) (Phorbol ester induced gene 1) (PEIG-1) (Retinoic acid-induced gene 1 protein) (RAIG-1)
Protein Class (3)
G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- G-protein coupled receptors:Family 3 (C) receptors
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
34..54; Helical; Name=1; 69..89; Helical; Name=2; 98..118; Helical; Name=3; 130..150; Helical; Name=4; 177..197; Helical; Name=5; 213..233; Helical; Name=6; 248..268; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
PEIG-1RAI3RAIG1TIG1
Gene Description
G protein-coupled receptor class C group 5 member A
Chromosome
12
Position
12891559-12917937
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificlungCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificclassical monocyteBlood Lineage SpecificB-cells
Function & Pathway
Protein Function (3)
- G-protein coupled receptors:Family 3 (C) receptors
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (7)
Molecular Function (4)
Biological Process (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence51
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| GPRC5A | EGFR | P00533 | Y | 350 | phosphorylation | REACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:25311788 |
| GPRC5A | EGFR | P00533 | Y | 320 | phosphorylation | REACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:25311788 |
| GPRC5A | EGFR | P00533 | Y | 317 | phosphorylation | REACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:25311788 |
| GPRC5A | EGFR | P00533 | Y | 347 | phosphorylation | REACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:25311788 |
Ligand-Receptor Signaling (43)
43 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | scConnect | Yes | Yes | |||
| receptor | receptor | Almen2009 | Yes | Yes | |||
| receptor | receptor | CellCellInteractions | Yes | Yes | |||
| gpcr | receptor | GPCRdb | Yes | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EGFR | P00533 | RAI3 | Q8NFJ5 | Yes | Yes | PhosphoSite_norefSIGNORiPTMnetProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:25311788PhosphoSite:25311788SIGNOR:25311788 |
Protein Complex Composition (2)
2 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains
Sequences
Length
357
Mass
40,251
Sequence
MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 3 family
Sequence Similarities
Belongs to the G-protein coupled receptor 3 family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 39025337 | Shotgun proteomics of thyroid carcinoma exosomes - Insight into the role of exosomal proteins in carcinogenesis and thyroid homeostasis. | No related sentences available |