Protein detail
RAI3
Retinoic acid-induced protein 3 (G-protein coupled receptor family C group 5 member A) (Phorbol ester induced gene 1) (PEIG-1) (Retinoic acid-induced gene 1 protein) (RAIG-1)
Protein symbol RAI3 | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count 7 | Protein classification G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Retinoic acid-induced protein 3 (G-protein coupled receptor family C group 5 member A) (Phorbol ester induced gene 1) (PEIG-1) (Retinoic acid-induced gene 1 protein) (RAIG-1)
Protein Class
G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- G-protein coupled receptors:Family 3 (C) receptors
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
34..54; Helical; Name=1; 69..89; Helical; Name=2; 98..118; Helical; Name=3; 130..150; Helical; Name=4; 177..197; Helical; Name=5; 213..233; Helical; Name=6; 248..268; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym
PEIG-1RAI3RAIG1TIG1
Gene Description
G protein-coupled receptor class C group 5 member A
Chromosome
12
Position
12891559-12917937
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue SpecificlungCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificclassical monocyteBlood Lineage SpecificB-cells
Function & Pathway
Protein Function
- G-protein coupled receptors:Family 3 (C) receptors
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Molecular Function
Biological Process
Mediation Categories
Receptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| GPRC5A | EGFR | P00533 | Y | 350 | phosphorylation | REACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:25311788 |
| GPRC5A | EGFR | P00533 | Y | 320 | phosphorylation | REACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:25311788 |
| GPRC5A | EGFR | P00533 | Y | 317 | phosphorylation | REACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:25311788 |
| GPRC5A | EGFR | P00533 | Y | 347 | phosphorylation | REACH_ProtMapperPhosphoSitePhosphoSite_ProtMapperProtMapper | ProtMapper:25311788 |
Ligand-Receptor Signaling
43 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| gpcr_orphan | receptor | HGNC | No | Yes | No | Yes | No |
| receptor | receptor | HGNC | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 5 of 5Previous
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EGFR | P00533 | RAI3 | Q8NFJ5 | Yes | No | Yes | PhosphoSite_norefSIGNORiPTMnetProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:25311788PhosphoSite:25311788SIGNOR:25311788 |
Protein Complex Composition
2 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains
Sequences
Length
357
Mass
40,251
Sequence
MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
3D Structural Models
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 3 family
Sequence Similarities
Belongs to the G-protein coupled receptor 3 family.