Protein detail
S22A8
Organic anion transporter 3 (hOAT3) (Organic anion/dicarboxylate exchanger) (Solute carrier family 22 member 8)
Entry name S22A8 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count 11 | Protein classification FDA approved drug targetsMetabolic proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
Organic anion transporter 3 (hOAT3) (Organic anion/dicarboxylate exchanger) (Solute carrier family 22 member 8)
Protein Class (4)
FDA approved drug targetsMetabolic proteinsPredicted membrane proteinsTransporters
Protein Function (2)
- Transporters:Electrochemical Potential-driven transporters
- FDA approved drug targets:Small molecule drugs
Transmembrane
10..30; Helical; 124..144; Helical; 155..175; Helical; 177..197; Helical; 213..233; Helical; 237..257; Helical; 328..348; Helical; 355..375; Helical; 387..407; Helical; 412..432; Helical; 472..492; Helical
Transmembrane Count
11
Ensembl
Entrez Gene Symbol
Gene Synonym
OAT3
Gene Description
Solute carrier family 22 member 8
Chromosome
11
Position
62989154-63015841
EVMP confidence score
0.38
Fluorescence & Localization2
Cell SpecificFibro-adipogenic progenitorsSingle-Nuclei Brain Specificoligodendrocyte
Function & Pathway7
Protein Function (2)
- Transporters:Electrochemical Potential-driven transporters
- FDA approved drug targets:Small molecule drugs
Cellular Component (4)
Molecular Function (4)
Biological Process (3)
Reactome (6)
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence21
Ligand-Receptor Signaling (20)
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | Ramilowski_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | Ramilowski_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
| cell_surface | cell_surface | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 2 of 2Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 14 | 3371834237862381389386743994949026538482315085003887173037702715327954143007131837033249376863664009834633114768 |
Sequence, Structure & Domains9
Sequences
Length
542
Mass
59,856
Sequence
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQIIFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKGCLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q8TCC7-1; Sequence=Displayed; Name=2; IsoId=Q8TCC7-2; Sequence=VSP_022565; Name=5; IsoId=Q8TCC7-5; Sequence=VSP_045824; Name=3; IsoId=Q8TCC7-3; Sequence=VSP_022562, VSP_022563, VSP_022564; Name=4; IsoId=Q8TCC7-4; Sequence=VSP_045272
Alternative Sequence
1..345; Missing (in isoform 3); 1..123; Missing (in isoform 5); 1..91; Missing (in isoform 4); 406..455; DLQTVRTVLAVFGKGCLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRV -> GERLGLPQNPLEEAARLGARDFTAGSASKSLCYLEQVPALSGAQGLSSRK (in isoform 3); 456..542; Missing (in isoform 3); 510; W -> WSVTASGPPR (in isoform 2)
Domain & Motif Annotations
Compositional Bias
517..527; Basic and acidic residues
Region
515..542; Disordered
Protein Families (2)
- Major facilitator (TC 2.A.1) superfamily
- Organic cation transporter (TC 2.A.1.19) family
Sequence Similarities
Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family.
Clinical Relevance6
Disease Involvement
FDA approved drug targets
Related Diseases (4)
Biomarker
Approved; Phase 2
Drug Targets
FDA approved drug targets
Drugs (15)
Antibody