Protein detail

C99L2

CD99 antigen-like protein 2 (MIC2-like protein 1) (CD antigen CD99)

Entry name C99L2	UniProt ID Q8TCZ2	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 1	Protein classification Predicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

CD99 antigen-like protein 2 (MIC2-like protein 1) (CD antigen CD99)

Protein Class (3)

Predicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins

Protein Function (2)

Predicted secreted proteins
Predicted intracellular proteins

Transmembrane

186..206; Helical

Transmembrane Count

Ensembl

ENSG00000102181

Entrez Gene Symbol

CD99L2

Gene Synonym (2)

CD99BMIC2L1

Gene Description

CD99 molecule like 2

Chromosome

Position

150766336-150898816

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization4

Tissue Specificadipose tissueCell SpecificEpicardial cellsBlood Cell SpecificeosinophilBlood Lineage Specificgranulocytes

Function & Pathway7

Protein Function (2)

Predicted secreted proteins
Predicted intracellular proteins

Cellular Component (5)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG (2)

Reactome (2)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence30

Ligand-Receptor Signaling (25)

25 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	TopDB	No	No	Yes	Yes	No
transmembrane	transmembrane	LOCATE	No	No	Yes	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	Yes	Yes	No
transmembrane	transmembrane	OmniPath	No	No	Yes	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	Yes	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	Yes	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	No	No	Yes	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	Yes	Yes	No
secreted	secreted	UniProt_keyword	No	No	Yes	Yes	No
secreted	secreted	UniProt_location	No	No	Yes	Yes	No

Page 2 of 3Previous Next

Protein Complex Composition (4)

4 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
CAPN1 CAPNS1 CAPNS2 CAST CD99L2 TRIP12	P04632 P07384 P20810 Q14669 Q8TCZ2 Q96L46	0:0:0:0:0:0	hu.MAP2
CAPN1 CAPNS1 CD99L2 RP9 TRIP12	P04632 P07384 Q14669 Q8TA86 Q8TCZ2	0:0:0:0:0	hu.MAP2
CAPN1 CAPNS1 CD99L2	P04632 P07384 Q8TCZ2	0:0:0	hu.MAP2
BHLHE41 CD99L2	Q8TCZ2 Q9C0J9	0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography		1	27086912

Sequence, Structure & Domains9

Sequences

Length

262

Mass

27,986

Sequence

MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI

Alternative Products

Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q8TCZ2-1; Sequence=Displayed; Name=2; IsoId=Q8TCZ2-2; Sequence=VSP_034184; Name=3; IsoId=Q8TCZ2-3; Sequence=VSP_034182, VSP_034183; Name=4; IsoId=Q8TCZ2-4; Sequence=VSP_034181, VSP_034185; Name=5; IsoId=Q8TCZ2-5; Sequence=VSP_041815, VSP_041816; Name=6; IsoId=Q8TCZ2-6; Sequence=VSP_044663

Alternative Sequence

44..145; QPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGF -> PALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISASVVTWCSPFCVSLLSLTKMLVSGFKAHLDNPG (in isoform 4); 44; Q -> R (in isoform 3); 45..116; Missing (in isoform 3); 45..93; Missing (in isoform 2); 68; G -> GPTEG (in isoform 5); 93..165; Missing (in isoform 6); 146..262; Missing (in isoform 4); 218..219; QQ -> QHAAAGQE (in isoform 5)

Domain & Motif Annotations

Compositional Bias

49..60; Low complexity; 98..119; Low complexity; 125..136; Basic and acidic residues; 159..168; Basic and acidic residues

Region

38..181; Disordered

Protein Families

CD99 family

Sequence Similarities

Belongs to the CD99 family.

Clinical Relevance4

Antibody (3)

HPA038782 HPA038783 HPA061400

Interaction Protein

ENSG00000104969

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
36982312	Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis.	No abstract available