Protein detail
C99L2
CD99 antigen-like protein 2 (MIC2-like protein 1) (CD antigen CD99)
Entry name C99L2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD99 antigen-like protein 2 (MIC2-like protein 1) (CD antigen CD99)
Protein Class (3)
Predicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Transmembrane
186..206; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD99BMIC2L1
Gene Description
CD99 molecule like 2
Chromosome
X
Position
150766336-150898816
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificadipose tissueCell SpecificEpicardial cellsBlood Cell SpecificeosinophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function
Biological Process (3)
KEGG (2)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence30
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | Yes | Yes | |||
| transmembrane | transmembrane | LOCATE | Yes | Yes | |||
| transmembrane | transmembrane | Ramilowski_location | Yes | Yes | |||
| transmembrane | transmembrane | OmniPath | Yes | Yes | |||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | Yes | |||
| plasma_membrane | plasma_membrane | OmniPath | Yes | Yes | |||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | Yes | |||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | Yes | |||
| secreted | secreted | UniProt_keyword | Yes | Yes | |||
| secreted | secreted | UniProt_location | Yes | Yes |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CAPN1CAPNS1CAPNS2CASTCD99L2TRIP12 | P04632P07384P20810Q14669Q8TCZ2Q96L46 | 0:0:0:0:0:0 | hu.MAP2 | |||
| CAPN1CAPNS1CD99L2RP9TRIP12 | P04632P07384Q14669Q8TA86Q8TCZ2 | 0:0:0:0:0 | hu.MAP2 | |||
| CAPN1CAPNS1CD99L2 | P04632P07384Q8TCZ2 | 0:0:0 | hu.MAP2 | |||
| BHLHE41CD99L2 | Q8TCZ2Q9C0J9 | 0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | 1 | 27086912 |
Sequence, Structure & Domains
Sequences
Length
262
Mass
27,986
Sequence
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q8TCZ2-1; Sequence=Displayed; Name=2; IsoId=Q8TCZ2-2; Sequence=VSP_034184; Name=3; IsoId=Q8TCZ2-3; Sequence=VSP_034182, VSP_034183; Name=4; IsoId=Q8TCZ2-4; Sequence=VSP_034181, VSP_034185; Name=5; IsoId=Q8TCZ2-5; Sequence=VSP_041815, VSP_041816; Name=6; IsoId=Q8TCZ2-6; Sequence=VSP_044663
Alternative Sequence
44..145; QPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGF -> PALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISASVVTWCSPFCVSLLSLTKMLVSGFKAHLDNPG (in isoform 4); 44; Q -> R (in isoform 3); 45..116; Missing (in isoform 3); 45..93; Missing (in isoform 2); 68; G -> GPTEG (in isoform 5); 93..165; Missing (in isoform 6); 146..262; Missing (in isoform 4); 218..219; QQ -> QHAAAGQE (in isoform 5)
Domain & Motif Annotations
Compositional Bias
49..60; Low complexity; 98..119; Low complexity; 125..136; Basic and acidic residues; 159..168; Basic and acidic residues
Region
38..181; Disordered
Protein Families
CD99 family
Sequence Similarities
Belongs to the CD99 family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 36982312 | Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis. | No related sentences available |