Protein detail
PAQR8
Membrane progestin receptor beta (mPR beta) (Lysosomal membrane protein in brain 1) (Membrane progesterone P4 receptor beta) (Membrane progesterone receptor beta) (Progesterone and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member VIII)
Entry name PAQR8 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Membrane progestin receptor beta (mPR beta) (Lysosomal membrane protein in brain 1) (Membrane progesterone P4 receptor beta) (Membrane progesterone receptor beta) (Progesterone and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member VIII)
Protein Function
Transporters:Transporter channels and pores
Transmembrane
76..96; Helical; Name=1; 112..132; Helical; Name=2; 175..195; Helical; Name=3; 214..234; Helical; Name=4; 244..264; Helical; Name=5; 284..304; Helical; Name=6; 320..340; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Secretome LocationIntracellular and membraneSecretome FunctionOther
Function & Pathway7
Protein Function
Transporters:Transporter channels and pores
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Canonical Pathways (3)
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Other mediation
Relations & Evidence17
Ligand-Receptor Signaling (16)
16 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
Page 1 of 2Next
Sequence, Structure & Domains5
Sequences
Length
354
Mass
40,464
Sequence
MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
Domain & Motif Annotations
Protein Families
ADIPOR family
Sequence Similarities
Belongs to the ADIPOR family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No abstract available |