Protein detail
PAQR8
Membrane progestin receptor beta (mPR beta) (Lysosomal membrane protein in brain 1) (Membrane progesterone P4 receptor beta) (Membrane progesterone receptor beta) (Progesterone and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member VIII)
Entry name PAQR8 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 7 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Membrane progestin receptor beta (mPR beta) (Lysosomal membrane protein in brain 1) (Membrane progesterone P4 receptor beta) (Membrane progesterone receptor beta) (Progesterone and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member VIII)
Protein Function
Transporters:Transporter channels and pores
Transmembrane
76..96; Helical; Name=1; 112..132; Helical; Name=2; 175..195; Helical; Name=3; 214..234; Helical; Name=4; 244..264; Helical; Name=5; 284..304; Helical; Name=6; 320..340; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Secretome LocationIntracellular and membraneSecretome FunctionOther
Function & Pathway
Protein Function
Transporters:Transporter channels and pores
Cellular Component
Molecular Function
Biological Process
Canonical Pathways
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Other mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
16 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | No | No |
| progestin_and_adipoq | receptor | HGNC | No | Yes | No | No | No |
| receptor | receptor | HGNC | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 2 of 2Previous
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Sequence, Structure & Domains
Sequences
Length
354
Mass
40,464
Sequence
MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
3D Structural Models
Domain & Motif Annotations
Protein Families
ADIPOR family
Sequence Similarities
Belongs to the ADIPOR family.