Protein detail
SSH1
Protein phosphatase Slingshot homolog 1 (EC 3.1.3.16) (EC 3.1.3.48) (SSH-like protein 1) (SSH-1L) (hSSH-1L)
Entry name SSH1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification EnzymesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Protein phosphatase Slingshot homolog 1 (EC 3.1.3.16) (EC 3.1.3.48) (SSH-like protein 1) (SSH-1L) (hSSH-1L)
Protein Class (2)
EnzymesPredicted intracellular proteins
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
KIAA1298SSH1L
Gene Description
Slingshot protein phosphatase 1
Chromosome
12
Position
108778191-108857590
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway6
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Cellular Component (8)
Molecular Function (5)
Biological Process (3)
Mediation Categories (3)
Fusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence25
Enzyme-Mediated Modification (12)
12 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SSH1 | PRKD1 | Q15139 | S | 937 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:19567672SIGNOR:21525957ProtMapper:21525957ProtMapper:19567672ProtMapper:19329994 |
| SSH1 | PRKD1 | Q15139 | S | 978 | phosphorylation | Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:19329994SIGNOR:19567672ProtMapper:19567672ProtMapper:26873625 |
| SSH1 | PRKD1 | Q15139 | S | 402 | phosphorylation | Sparser_ProtMapperPhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:23153585 |
| SSH1 | PRKD1 | Q15139 | S | 929 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:25266776 |
| SSH1 | PRKD2 | Q9BZL6 | S | 937 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:21525957SIGNOR:21525957 |
| SSH1 | PRKD2 | Q9BZL6 | S | 978 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:24840177 |
| SSH1 | AKT1 | P31749 | T | 826 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| SSH1 | RHOA | P61586 | S | 978 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:19329994 |
| SSH1 | PKD1 | P98161 | S | 978 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:19329994 |
| SSH1 | PKD1 | P98161 | S | 937 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:19329994 |
Page 1 of 2Next
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (7)
7 records.
Sequence, Structure & Domains10
Sequences
Length
1,049
Mass
115,511
Sequence
MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPALFVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEMLLILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFLPETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREALLEEAAPPAEVHRPARQPQQGSGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGRWGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILNKVKPSYKSCADCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGSRRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPPFFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQGTPRDPAATSKPSGKPAPENLKSPSWMSKS
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=L; IsoId=Q8WYL5-1; Sequence=Displayed; Name=2; Synonyms=S; IsoId=Q8WYL5-2; Sequence=VSP_016318, VSP_016319; Name=3; Synonyms=B; IsoId=Q8WYL5-3; Sequence=VSP_016312, VSP_016314, VSP_016315, VSP_016316; Name=4; IsoId=Q8WYL5-4; Sequence=VSP_016311, VSP_016317; Name=5; IsoId=Q8WYL5-5; Sequence=VSP_016313, VSP_016318, VSP_016319
Alternative Sequence
1..312; Missing (in isoform 4); 1..73; Missing (in isoform 3); 1..37; MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLS -> MARARRAVVGSVRDVSTAATNLFYFTDFCIFLQPTHCFCCPEVSSSNY (in isoform 5); 74..93; LPQHLQVMINLLRCEDRIKL -> MGGRHHLQRQVSESMSALFQ (in isoform 3); 135..157; Missing (in isoform 3); 245..1049; Missing (in isoform 3); 313..334; FDHLYLGSEWNASNLEELQGSG -> MRCYLSWDRWTSPPLSSIIFIS (in isoform 4); 632..692; DDAIFGILNKVKPSYKSCADCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVA -> VGRARPAGWHTPSLPSHSNWPTSASVVGTTGTRHHTQLIFFYCLLWAPSSHLQGPEGSFTG (in isoform 2 and isoform 5); 693..1049; Missing (in isoform 2 and isoform 5)
Domain & Motif Annotations
Compositional Bias
1..12; Polar residues; 13..25; Low complexity; 458..468; Polar residues; 564..573; Basic and acidic residues; 731..742; Low complexity; 772..787; Basic and acidic residues; 925..943; Low complexity; 1001..1013; Polar residues
Domain (FT)
249..304; DEK-C; 308..449; Tyrosine-protein phosphatase
Region
1..28; Disordered; 456..499; Disordered; 544..603; Disordered; 693..787; Disordered; 825..899; Disordered; 897..1049; Interaction with YWHAG; 923..955; Disordered; 989..1049; Disordered
Protein Families
Protein-tyrosine phosphatase family
Sequence Similarities
Belongs to the protein-tyrosine phosphatase family.
Clinical Relevance4
Antibody
Interaction Protein
ENSG00000134308
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 35289120 | Tumor Derived Extracellular Vesicles Drive T Cell Exhaustion in Tumor Microenvironment through Sphingosine Mediated Signaling and Impacting Immunotherapy Outcomes in Ovarian Cancer. | Here, extracellular vesicles (EVs) are identified as the key transporters of SPHK1 to the tumor microenvironment. |