Protein detail

SSH1

Protein phosphatase Slingshot homolog 1 (EC 3.1.3.16) (EC 3.1.3.48) (SSH-like protein 1) (SSH-1L) (hSSH-1L)

Entry name SSH1	UniProt ID Q8WYL5	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification EnzymesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein phosphatase Slingshot homolog 1 (EC 3.1.3.16) (EC 3.1.3.48) (SSH-like protein 1) (SSH-1L) (hSSH-1L)

Protein Class (2)

EnzymesPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000084112

Entrez Gene Symbol

SSH1

Gene Synonym (2)

KIAA1298SSH1L

Gene Description

Slingshot protein phosphatase 1

Chromosome

Position

108778191-108857590

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Function & Pathway6

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (8)

Molecular Function (5)

Biological Process (3)

KEGG (2)

Mediation Categories (3)

Fusion and delivery mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence25

Enzyme-Mediated Modification (12)

12 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
SSH1	PKD2	Q13563	S	978	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:24840177
SSH1	PRKD3	O94806	S	978	phosphorylation	RLIMS-P_ProtMapperProtMapper	ProtMapper:24840177

Page 2 of 2Previous

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KPCD1	Q15139	SSH1	Q8WYL5	Yes	Yes	Yes	Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:19329994 SIGNOR:19567672 SIGNOR:21525957 ProtMapper:26873625 PhosphoSite:15159416 PhosphoSite:21525957 PhosphoSite:19567672 SIGNOR:21832093 ProtMapper:19329994 PhosphoSite:23737525 ProtMapper:33324642 ProtMapper:23688773 SIGNOR:23841590 PhosphoSite:24962708 PhosphoSite:24840177 ProtMapper:21525957 ProtMapper:25266776 ProtMapper:23153585 ProtMapper:19567672
KPCD2	Q9BZL6	SSH1	Q8WYL5	Yes	No	Yes	Sparser_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:21525957 SIGNOR:21525957 SIGNOR:21832093 ProtMapper:24840177
SSH1	Q8WYL5	COF1	P23528	Yes	Yes	No	WangAdhesomeNCI-PID_ProtMapperSIGNORProtMapperDEPODHPRDHINTSIGNOR_ProtMapperHPRD-phosSPIKE_LC	HPRD:12684437 Adhesome:10592173 DEPOD:11832213 SIGNOR:14531860 Adhesome:12684437 ProtMapper:14531860 Adhesome:21525957 HINT:25100728 SPIKE_LC:16713569 HPRD-phos:12684437 HPRD:11832213 Adhesome:11832213 DEPOD:14531860 ProtMapper:16230460 HINT:21525957
SSH1	Q8WYL5	LIMK1	P53667	Yes	No	Yes	DEPODSIGNORIntActAdhesome	SIGNOR:23153585 IntAct:15660133 Adhesome:11832213 Adhesome:15660133 DEPOD:15660133
IRS4	O14654	SSH1	Q8WYL5	Yes	Yes	No	SIGNOR	SIGNOR:25100728
SSH1	Q8WYL5	COR1B	Q9BR76	Yes	Yes	No	AdhesomeSIGNORProtMapperDEPODHPRDSIGNOR_ProtMapper	DEPOD:17350576 ProtMapper:17350576 SIGNOR:17350576 Adhesome:17350576 HPRD:17350576
KPCD3	O94806	SSH1	Q8WYL5	Yes	No	Yes	RLIMS-P_ProtMapperSIGNORProtMapper	SIGNOR:21832093 ProtMapper:24840177

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	2	39766158 36398564

Sequence, Structure & Domains10

Sequences

Length

1,049

Mass

115,511

Sequence

MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPALFVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEMLLILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFLPETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREALLEEAAPPAEVHRPARQPQQGSGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGRWGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILNKVKPSYKSCADCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGSRRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPPFFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQGTPRDPAATSKPSGKPAPENLKSPSWMSKS

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=L; IsoId=Q8WYL5-1; Sequence=Displayed; Name=2; Synonyms=S; IsoId=Q8WYL5-2; Sequence=VSP_016318, VSP_016319; Name=3; Synonyms=B; IsoId=Q8WYL5-3; Sequence=VSP_016312, VSP_016314, VSP_016315, VSP_016316; Name=4; IsoId=Q8WYL5-4; Sequence=VSP_016311, VSP_016317; Name=5; IsoId=Q8WYL5-5; Sequence=VSP_016313, VSP_016318, VSP_016319

Alternative Sequence

1..312; Missing (in isoform 4); 1..73; Missing (in isoform 3); 1..37; MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLS -> MARARRAVVGSVRDVSTAATNLFYFTDFCIFLQPTHCFCCPEVSSSNY (in isoform 5); 74..93; LPQHLQVMINLLRCEDRIKL -> MGGRHHLQRQVSESMSALFQ (in isoform 3); 135..157; Missing (in isoform 3); 245..1049; Missing (in isoform 3); 313..334; FDHLYLGSEWNASNLEELQGSG -> MRCYLSWDRWTSPPLSSIIFIS (in isoform 4); 632..692; DDAIFGILNKVKPSYKSCADCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVA -> VGRARPAGWHTPSLPSHSNWPTSASVVGTTGTRHHTQLIFFYCLLWAPSSHLQGPEGSFTG (in isoform 2 and isoform 5); 693..1049; Missing (in isoform 2 and isoform 5)

Domain & Motif Annotations

Compositional Bias

1..12; Polar residues; 13..25; Low complexity; 458..468; Polar residues; 564..573; Basic and acidic residues; 731..742; Low complexity; 772..787; Basic and acidic residues; 925..943; Low complexity; 1001..1013; Polar residues

Domain (FT)

249..304; DEK-C; 308..449; Tyrosine-protein phosphatase

Region

1..28; Disordered; 456..499; Disordered; 544..603; Disordered; 693..787; Disordered; 825..899; Disordered; 897..1049; Interaction with YWHAG; 923..955; Disordered; 989..1049; Disordered

Protein Families

Protein-tyrosine phosphatase family

Sequence Similarities

Belongs to the protein-tyrosine phosphatase family.

Clinical Relevance4

Antibody

HPA019845

Interaction Protein

ENSG00000134308

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
35289120	Tumor Derived Extracellular Vesicles Drive T Cell Exhaustion in Tumor Microenvironment through Sphingosine Mediated Signaling and Impacting Immunotherapy Outcomes in Ovarian Cancer.	Here, extracellular vesicles (EVs) are identified as the key transporters of SPHK1 to the tumor microenvironment.