Protein detail
SYMPK
Symplekin
Entry name SYMPK | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Essential proteinsPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Symplekin
Protein Class (3)
Essential proteinsPlasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
Pta1SPKSYM
Gene Description
Symplekin scaffold protein
Chromosome
19
Position
45815410-45863194
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization6
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificclassical monocyteBlood Lineage Specificgranulocytes
Function & Pathway8
Protein Function
Predicted intracellular proteins
Cellular Component (9)
Molecular Function
Biological Process (3)
Reactome (14)
- R-hsa-9918481 dengue virus host interactions
- R-hsa-9839923 dengue virus infection
- R-hsa-5663205 infectious disease
- R-hsa-8953854 metabolism of rna
- R-hsa-72187 mrna 3 end processing
- R-hsa-9770562 mrna polyadenylation
- R-hsa-75067 processing of capped intronless pre mrna
- R-hsa-72203 processing of capped intron containing pre mrna
- R-hsa-77595 processing of intronless pre mrnas
- R-hsa-73857 rna polymerase ii transcription
Page 1 of 2
Canonical Pathways (3)
- M5883 Naba secreted factors
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence25
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SYMPK | MAPK3 | P27361 | T | 1,257 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| SYMPK | MAPK8 | P45983 | S | 1,243 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | No | No | No |
| tight_junction | tight_junction | OmniPath | Yes | Yes | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MK03 | P27361 | SYMPK | Q92797 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:28630428 |
Protein Complex Composition (10)
10 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Histone pre-RNA core cleavage complex | CPSF2CPSF3CSTF2SYMPK | P33240Q92797Q9P2I0Q9UKF6 | 1:1:1:1 | ComplexPortal | intact:EBI-9023470 | 23071092147552923202963134230059 |
| POL2R-SYMPK-SSU72 complex | POLR2ASSU72SYMPK | P24928Q92797Q9NP77 | 0:0:0 | CORUM | CORUM:6218 | 20861839 |
| Polyadenylation complex (CSTF1CSTF2CSTF3SYMPK CPSF1CPSF2CPSF3) | CPSF1CPSF2CPSF3CSTF1CSTF2CSTF3SYMPK | P33240Q05048Q10570Q12996Q92797Q9P2I0Q9UKF6 | 1:1:1:1:1:1:1 | CompleatCORUM | CORUM:1147Compleat:HC3064 | 10669729 |
| pre-mRNA cleavage and polyadenylation specificity factor complex | CPSF1CPSF2CPSF3CPSF4FIP1L1SYMPKWDR33 | O95639Q10570Q6UN15Q92797Q9C0J8Q9P2I0Q9UKF6 | 1:1:1:1:1:1:1 | ComplexPortalhu.MAPhu.MAP2 | PDB:6fuwPDB:6BM0PDB:6fbsPDB:7k95PDB:6f9nPDB:6BLYintact:EBI-9023581 | 3517753614755292293587582920871133122294 |
| CPSF1CPSF2CPSF3CPSF4FIP1L1SYMPK | O95639Q10570Q6UN15Q92797Q9P2I0Q9UKF6 | 0:0:0:0:0:0 | hu.MAP | |||
| CPSF2CPSF3LSM10LSM11SNRPBSNRPD3SNRPESNRPFSNRPGSYMPK | P14678P62304P62306P62308P62318P83369Q92797Q969L4Q9P2I0Q9UKF6 | 1:1:1:1:1:1:1:1:1:1 | PDB | PDB:6v4x | ||
| AHCYL2ANP32APTSSYMPKTPI1 | P39687P60174Q03393Q92797Q96HN2 | 1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8462 | ||
| CHD3SYMPK | Q12873Q92797 | 0:0 | hu.MAP2 | |||
| CHD5SYMPK | Q8TDI0Q92797 | 0:0 | hu.MAP2 | |||
| SSU72SYMPK | Q92797Q9NP77 | 2:2 | PDB | PDB:4h3hPDB:3o2sPDB:3o2qPDB:4h3k |
Sequence, Structure & Domains15
Sequences
Length
1,274
Mass
141,148
Sequence
MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKMKLEPNLGEDDEDKDLEPGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPRLAGAGGRKKIFRLSDVLKPLTDAQVEAMKLGAVKRILRAEKAVACSGAAQVRIKILASLVTQFNSGLKAEVLSFILEDVRARLDLAFAWLYQEYNAYLAAGASGSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAPLITESALEVVRKYCEDESRTYLGMSTLRDLIFKRPSRQFQYLHVLLDLSSHEKDKVRSQALLFIKRMYEKEQLREYVEKFALNYLQLLVHPNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGAETLVTRCLHSLTDKVPPSPELVKRVRDLYHKRLPDVRFLIPVLNGLEKKEVIQALPKLIKLNPIVVKEVFNRLLGTQHGEGNSALSPLNPGELLIALHNIDSVKCDMKSIIKATNLCFAERNVYTSEVLAVVMQQLMEQSPLPMLLMRTVIQSLTMYPRLGGFVMNILSRLIMKQVWKYPKVWEGFIKCCQRTKPQSFQVILQLPPQQLGAVFDKCPELREPLLAHVRSFTPHQQAHIPNSIMTILEASGKQEPEAKEAPAGPLEEDDLEPLTLAPAPAPRPPQDLIGLRLAQEKALKRQLEEEQKLKPGGVGAPSSSSPSPSPSARPGPPPSEEAMDFREEGPECETPGIFISMDDDSGLTEAALLDSSLEGPLPKETAAGGLTLKEERSPQTLAPVGEDAMKTPSPAAEDAREPEAKGNS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q92797-1; Sequence=Displayed; Name=2; IsoId=Q92797-2; Sequence=VSP_014842, VSP_014843
Alternative Sequence
637..672; GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAP -> PRLCWRRHSSQRVPWRWSASTARMRVAPIWACPHFET (in isoform 2); 673..1274; Missing (in isoform 2)
3D Structural Models
Helix
32..45; 50..63; 67..73; 74..78; 79..82; 86..102; 104..106; 107..118; 123..146; 152..170; 171..173; 177..193; 205..207; 213..215; 225..242; 250..266; 268..270; 271..283; 287..289; 291..293; 294..309; 312..317; 318..327; 332..337; 342..345
Beta Strand
221..223
3D Structure
Electron microscopy (1); X-ray crystallography (7)
Domain & Motif Annotations
Compositional Bias
349..362; Basic and acidic residues; 380..392; Polar residues; 1149..1159; Basic and acidic residues; 1173..1185; Pro residues; 1263..1274; Basic and acidic residues
Repeat
31..64; HEAT 1; 67..101; HEAT 2; 104..146; HEAT 3; 153..192; HEAT 4; 227..266; HEAT 5
Motif
345..360; Nuclear localization signal
Domain (CC)
The HEAT repeats have been determined based on 3D-structure analysis of the D.melanogaster ortholog and are not detected by sequence-based prediction programs.
Region
1..124; Interaction with HSF1; 335..392; Disordered; 1102..1137; Disordered; 1149..1274; Disordered
Protein Families
Symplekin family
Sequence Similarities
Belongs to the Symplekin family.
Clinical Relevance4
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 37980468 | Lymphocyte migration regulation related proteins in urine exosomes may serve as a potential biomarker for lung cancer diagnosis. | Lung cancer patients had reduced expression of WASL and increased expression of STK10 and WNK1 proteins in urine exosomes compared to normal people. |