Protein detail
NEO1
Neogenin (Immunoglobulin superfamily DCC subclass member 2)
Entry name NEO1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesPlasma proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Neogenin (Immunoglobulin superfamily DCC subclass member 2)
Protein Class (3)
Cancer-related genesPlasma proteinsPredicted membrane proteins
Protein Function
Cancer-related genes:Candidate cancer biomarkers
Transmembrane
1106..1126; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
HsT17534IGDCC2NGNNTN1R2
Gene Description
Neogenin 1
Chromosome
15
Position
73051710-73305205
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization5
Tissue SpecificliverBrain Regional Specificchoroid plexusCell SpecificHepatocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway7
Protein Function
Cancer-related genes:Candidate cancer biomarkers
Cellular Component (9)
Molecular Function (5)
Biological Process (3)
KEGG (3)
Reactome (3)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence73
Ligand-Receptor Signaling (63)
63 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| receptor | receptor | Baccin2019 | No | Yes | No | Yes | No |
| ig_like | receptor | Almen2009 | No | Yes | No | Yes | No |
| netrin | receptor | Almen2009 | No | Yes | No | Yes | No |
Page 1 of 7Next
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| NEO1 | Q92859 | BMP4 | P12644 | Yes | No | Yes | SignaLink3 | SignaLink3:21149453 |
| NEO1 | Q92859 | BMP2 | P12643 | Yes | No | Yes | HINTSignaLink3 | SignaLink3:21149453HINT:25938661HINT:18335997 |
| NET3 | O00634 | NEO1 | Q92859 | Yes | Yes | No | HPMRFantom5_LRdbCellTalkDBHPMR_LRdbHPRD_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020HPRDHPRD_talklrCellinkerWangLRdbSTRING_talklrHPMR_talklr | LRdb:15520228CellTalkDB:15520228Cellinker:15520228HPRD:10366627SIGNOR:28245592connectomeDB2020:10366627connectomeDB2020:15520228LRdb:1Cellinker:10366627HPMR:15520228 |
| RGMA | Q96B86 | NEO1 | Q92859 | Yes | Yes | Yes | HPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020Baccin2019Ramilowski2015_Baccin2019CellinkerWangLRdbSTRING_talklrEMBRACEHPMR_talklr | Baccin2019:15258590connectomeDB2020:15258590SIGNOR:18485097LRdb:15258590Cellinker:15258590HPMR:15258590 |
| NET4 | Q9HB63 | NEO1 | Q92859 | Yes | Yes | No | SIGNOR | SIGNOR:28245592 |
| NET1 | O95631 | NEO1 | Q92859 | Yes | Yes | No | Fantom5_LRdbCellTalkDBHPRD_LRdbiTALKtalklrSIGNORconnectomeDB2020HPRDHPRD_talklrBaccin2019Ramilowski2015_Baccin2019CellinkerLRdbSTRING_talklrEMBRACERamilowski2015 | Baccin2019:12636918HPRD:12636918CellTalkDB:8861902HPRD:8861902LRdb:126Cellinker:8861902Cellinker:12636918SIGNOR:28245592Baccin2019:8861902connectomeDB2020:8861902connectomeDB2020:12636918LRdb:8861902 |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Ultrafiltration / Tangential Flow Filtration | Mass spectrometry | 1 | 34063765 |
Sequence, Structure & Domains15
Sequences
Length
1,461
Mass
160,017
Sequence
MAAERGARRLLSTPSFWLYCLLLLGRRAPGAAAARSGSAPQSPGASIRTFTPFYFLVEPVDTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHNKPDEGYYQCVATVESLGTIISRTAKLIVAGLPRFTSQPEPSSVYAGNNAILNCEVNADLVPFVRWEQNRQPLLLDDRVIKLPSGMLVISNATEGDGGLYRCVVESGGPPKYSDEVELKVLPDPEVISDLVFLKQPSPLVRVIGQDVVLPCVASGLPTPTIKWMKNEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNIYAHESMDIVFECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLIILEHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPNDQASGSGGKGSRLPDLGSDYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVIIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPTYDPALPSTPLLSQQALNHHIHSVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA
Alternative Products
Event=Alternative splicing; Named isoforms=4; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q92859-1; Sequence=Displayed; Name=2; IsoId=Q92859-2; Sequence=VSP_002593; Name=3; IsoId=Q92859-3; Sequence=VSP_043330; Name=4; IsoId=Q92859-4; Sequence=VSP_047134
Alternative Sequence
1054..1064; Missing (in isoform 4); 1248..1301; PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE -> Q (in isoform 3); 1248..1300; Missing (in isoform 2)
3D Structural Models
Turn
659..661
Helix
780..782; 1002..1004
Beta Strand
443..450; 455..460; 470..479; 486..489; 496..500; 508..516; 521..524; 528..531; 546..551; 554..558; 570..578; 587..589; 591..596; 604..612; 638..643; 646..655; 666..670; 672..675; 678..683; 693..697; 704..708; 710..713; 716..720; 724..727; 743..750; 753..759; 770..775; 783..786; 793..796; 808..812; 858..864; 866..868; 870..875; 881..883; 890..897; 906..917; 925..934; 945..948; 959..966; 969..978; 989..996; 998..1000; 1005..1013; 1015..1019; 1027..1036; 1047..1050
3D Structure
NMR spectroscopy (6); X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
1052..1061; Basic and acidic residues; 1087..1097; Polar residues; 1191..1206; Polar residues; 1289..1322; Polar residues; 1330..1349; Polar residues; 1366..1375; Pro residues
Domain (CC)
The Fibronectin repeats 5 and 6 mediate interaction with RGM family molecules.
Domain (FT)
52..141; Ig-like C2-type 1; 152..238; Ig-like C2-type 2; 243..336; Ig-like C2-type 3; 341..426; Ig-like C2-type 4; 441..535; Fibronectin type-III 1; 541..631; Fibronectin type-III 2; 636..731; Fibronectin type-III 3; 741..831; Fibronectin type-III 4; 856..952; Fibronectin type-III 5; 957..1054; Fibronectin type-III 6
Region
1041..1097; Disordered; 1138..1160; Disordered; 1174..1206; Disordered; 1235..1276; Disordered; 1289..1381; Disordered
Protein Families (2)
- Immunoglobulin superfamily
- DCC family
Sequence Similarities
Belongs to the immunoglobulin superfamily. DCC family.
Clinical Relevance2
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |