Protein detail

NEO1

Neogenin (Immunoglobulin superfamily DCC subclass member 2)

Entry name NEO1	UniProt ID Q92859	EVMP score 0.50
Frequency 1	Transmembrane count 1	Protein classification Cancer-related genesPlasma proteinsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Neogenin (Immunoglobulin superfamily DCC subclass member 2)

Protein Class

Cancer-related genesPlasma proteinsPredicted membrane proteins

Protein Function

Cancer-related genes:Candidate cancer biomarkers

Transmembrane

1106..1126; Helical

Transmembrane Count

Ensembl

ENSG00000067141

Entrez Gene Symbol

NEO1

Gene Synonym

HsT17534IGDCC2NGNNTN1R2

Gene Description

Neogenin 1

Chromosome

Position

73051710-73305205

Frequency

EVMP Score

0.50

Fluorescence & Localization

Tissue SpecificliverBrain Regional Specificchoroid plexusCell SpecificHepatocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell

Function & Pathway

Protein Function

Cancer-related genes:Candidate cancer biomarkers

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Fusion and delivery mediationMetabolism mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

63 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
netrin	receptor	HPMR	No	Yes	No	Yes	No
dcc	receptor	HPMR	No	Yes	No	Yes	No
ig	receptor	Surfaceome	No	Yes	No	Yes	No
netrinr	receptor	Surfaceome	No	Yes	No	Yes	No
growth_factor	receptor	ICELLNET	No	Yes	No	Yes	No
cell_adhesion	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	HPMR	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No

Page 2 of 7Previous Next

Regulatory Interaction Network

6 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
NEO1	Q92859	BMP4	P12644	Yes	No	Yes	SignaLink3	SignaLink3:21149453
NEO1	Q92859	BMP2	P12643	Yes	No	Yes	HINTSignaLink3	SignaLink3:21149453 HINT:25938661 HINT:18335997
NET3	O00634	NEO1	Q92859	Yes	Yes	No	HPMRFantom5_LRdbCellTalkDBHPMR_LRdbHPRD_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020HPRDHPRD_talklrCellinkerWangLRdbSTRING_talklrHPMR_talklr	LRdb:15520228 CellTalkDB:15520228 Cellinker:15520228 HPRD:10366627 SIGNOR:28245592 connectomeDB2020:10366627 connectomeDB2020:15520228LRdb:1Cellinker:10366627 HPMR:15520228
RGMA	Q96B86	NEO1	Q92859	Yes	Yes	Yes	HPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020Baccin2019Ramilowski2015_Baccin2019CellinkerWangLRdbSTRING_talklrEMBRACEHPMR_talklr	Baccin2019:15258590 connectomeDB2020:15258590 SIGNOR:18485097 LRdb:15258590 Cellinker:15258590 HPMR:15258590
NET4	Q9HB63	NEO1	Q92859	Yes	Yes	No	SIGNOR	SIGNOR:28245592
NET1	O95631	NEO1	Q92859	Yes	Yes	No	Fantom5_LRdbCellTalkDBHPRD_LRdbiTALKtalklrSIGNORconnectomeDB2020HPRDHPRD_talklrBaccin2019Ramilowski2015_Baccin2019CellinkerLRdbSTRING_talklrEMBRACERamilowski2015	Baccin2019:12636918 HPRD:12636918 CellTalkDB:8861902 HPRD:8861902LRdb:126Cellinker:8861902 Cellinker:12636918 SIGNOR:28245592 Baccin2019:8861902 connectomeDB2020:8861902 connectomeDB2020:12636918 LRdb:8861902

Protein Complex Composition

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
NEO1 TNF TNFRSF1A	P01375 P19438 Q92859	0:0:0	hu.MAP
BMP2 NEO1 RGMB	P12643 Q6NW40 Q92859	1:2:1	PDB	PDB:4ui2
GK NEO1	P32189 Q92859	0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Ultrafiltration / Tangential Flow Filtration	Mass spectrometry	1	34063765

Sequence, Structure & Domains

Sequences

Length

1,461

Mass

160,017

Sequence

MAAERGARRLLSTPSFWLYCLLLLGRRAPGAAAARSGSAPQSPGASIRTFTPFYFLVEPVDTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHNKPDEGYYQCVATVESLGTIISRTAKLIVAGLPRFTSQPEPSSVYAGNNAILNCEVNADLVPFVRWEQNRQPLLLDDRVIKLPSGMLVISNATEGDGGLYRCVVESGGPPKYSDEVELKVLPDPEVISDLVFLKQPSPLVRVIGQDVVLPCVASGLPTPTIKWMKNEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNIYAHESMDIVFECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLIILEHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPNDQASGSGGKGSRLPDLGSDYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVIIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPTYDPALPSTPLLSQQALNHHIHSVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA

Alternative Products

Event=Alternative splicing; Named isoforms=4; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q92859-1; Sequence=Displayed; Name=2; IsoId=Q92859-2; Sequence=VSP_002593; Name=3; IsoId=Q92859-3; Sequence=VSP_043330; Name=4; IsoId=Q92859-4; Sequence=VSP_047134

Alternative Sequence

1054..1064; Missing (in isoform 4); 1248..1301; PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE -> Q (in isoform 3); 1248..1300; Missing (in isoform 2)

3D Structural Models

Turn

659..661

Helix

780..782; 1002..1004

Beta Strand

443..450; 455..460; 470..479; 486..489; 496..500; 508..516; 521..524; 528..531; 546..551; 554..558; 570..578; 587..589; 591..596; 604..612; 638..643; 646..655; 666..670; 672..675; 678..683; 693..697; 704..708; 710..713; 716..720; 724..727; 743..750; 753..759; 770..775; 783..786; 793..796; 808..812; 858..864; 866..868; 870..875; 881..883; 890..897; 906..917; 925..934; 945..948; 959..966; 969..978; 989..996; 998..1000; 1005..1013; 1015..1019; 1027..1036; 1047..1050

3D Structure

NMR spectroscopy (6); X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

1052..1061; Basic and acidic residues; 1087..1097; Polar residues; 1191..1206; Polar residues; 1289..1322; Polar residues; 1330..1349; Polar residues; 1366..1375; Pro residues

Domain (CC)

The Fibronectin repeats 5 and 6 mediate interaction with RGM family molecules.

Domain (FT)

52..141; Ig-like C2-type 1; 152..238; Ig-like C2-type 2; 243..336; Ig-like C2-type 3; 341..426; Ig-like C2-type 4; 441..535; Fibronectin type-III 1; 541..631; Fibronectin type-III 2; 636..731; Fibronectin type-III 3; 741..831; Fibronectin type-III 4; 856..952; Fibronectin type-III 5; 957..1054; Fibronectin type-III 6

Region

1041..1097; Disordered; 1138..1160; Disordered; 1174..1206; Disordered; 1235..1276; Disordered; 1289..1381; Disordered

Protein Families

Immunoglobulin superfamily
DCC family

Sequence Similarities

Belongs to the immunoglobulin superfamily. DCC family.

Clinical Relevance

Disease Involvement

Cancer-related genes

Antibody

CAB009320 HPA027804 HPA027805 HPA027806