Protein detail

TNR14

Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)

Entry name TNR14	UniProt ID Q92956	EVMP confidence score 0.63
Supporting publications (n) 9	Transmembrane count 1	Protein classification Cancer-related genesCD markersHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)

Protein Class (5)

Cancer-related genesCD markersHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins

Protein Function (5)

Predicted intracellular proteins
Cancer-related genes:Mutated cancer genes
CD markers
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues

Transmembrane

203..223; Helical

Transmembrane Count

Ensembl

ENSG00000157873

Entrez Gene Symbol

TNFRSF14

Gene Synonym (6)

ATARCD270HVEAHVEMLIGHTRTR2

Gene Description

TNF receptor superfamily member 14

Chromosome

Position

2555639-2565382

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization5

Tissue SpecificretinaCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes

Function & Pathway7

Protein Function (5)

Predicted intracellular proteins
Cancer-related genes:Mutated cancer genes
CD markers
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues

Cellular Component (2)

Molecular Function (5)

Biological Process (3)

KEGG (4)

Reactome (6)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence74

Ligand-Receptor Signaling (68)

68 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellPhoneDB	No	Yes	No	Yes	No
receptor	receptor	GO_Intercell	No	Yes	No	Yes	No
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	CellChatDB	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	Kirouac2010	No	Yes	No	Yes	No
receptor	receptor	Guide2Pharma	No	Yes	No	Yes	No

Page 1 of 7Next

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
TNR14	Q92956	TRAF5	O00463	Yes	Yes	No	KEGG-MEDICUSSIGNORHPRDHINTIntActSPIKE_LCLit-BM-17	IntAct:9162022 HPRD:9153189 IntAct:9153189 SPIKE_LC:9153189 SPIKE_LC:17145710 SIGNOR:9153189 Lit-BM-17:9153189 HINT:9162022 Lit-BM-17:9162022 HINT:9153189
TNF14	O43557	TNR14	Q92956	Yes	Yes	No	iTALKKirouac2010KEGG-MEDICUSGuide2Pharma_LRdbICELLNETSIGNORHINTInnateDBLit-BM-17HPMR_talklrHPMRCellChatDBHPRD_LRdbDLRP_CellinkertalklrscConnectHPRDIntActDLRP_talklrRamilowski2015_Baccin2019Guide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrBaccin2019CellinkerSTRING_talklrEMBRACECellCallGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020SPIKE_LCLRdb	Lit-BM-17:26977880 ICELLNET:11239407 LRdb:11390428 connectomeDB2020:11390428 Lit-BM-17:9462508 Lit-BM-17:10318773 IntAct:9462508 LRdb:10894944 HPRD:11390428 HINT:26977880 SIGNOR:10894944 SPIKE_LC:9462508 IntAct:26977880 LRdb:9462508 HINT:11390428 Baccin2019:11390428 HINT:34709351 HINT:10799510 CellTalkDB:10894944 Cellinker:10894944 HPMR:10894944 Baccin2019:9462508 Cellinker:9462508 Baccin2019:10894944 connectomeDB2020:10894944 InnateDB:11164894 Lit-BM-17:11390428 Cellinker:11390428 IntAct:10318773 HPRD:9462508 connectomeDB2020:9462508 SPIKE_LC:16189514

Protein Complex Composition (3)

3 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
Lymphotoxin-alpha-TNFRSF14 receptor complex	LTA TNFRSF14	P01374 Q92956	3:3	ComplexPortal		18613837 14755292 23524463 9462508
TNFSF14-TNFRSF14 receptor complex	TNFRSF14 TNFSF14	O43557 Q92956	3:3	ComplexPortalPDB	PDB:5T2QPDB:4RSUPDB:4FHQPDB:4rsuPDB:4EN0PDB:5T2RPDB:7msg	18613837 20592286 14755292 37167762 34709351 35604387
	TNFRSF14	Q92956	2	PDB	PDB:5t2qPDB:5t2r

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Size Exclusion Chromatography	Mass spectrometryR Sequencing	1	38343172

Sequence, Structure & Domains12

Sequences

Length

283

Mass

30,392

Sequence

MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q92956-1; Sequence=Displayed; Name=2; IsoId=Q92956-2; Sequence=VSP_054186

Alternative Sequence

1..100; MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD -> MVSRPPRTPLSPSSWT (in isoform 2)

3D Structural Models

Helix

101..103

Beta Strand

46..49; 52..55; 61..65; 69..71; 74..77; 86..88; 105..109; 113..115; 118..121; 126..131; 134..139

3D Structure

X-ray crystallography (8)

Domain & Motif Annotations

Repeat

42..75; TNFR-Cys 1; 78..119; TNFR-Cys 2; 121..162; TNFR-Cys 3

Domain (CC)

The cysteine rich domain I (CRD1/TNFR-Cys 1) is required for interaction with BY55 and BTLA.

Protein Families

Tumor necrosis factor receptor superfamily

Sequence Similarities

Belongs to the tumor necrosis factor receptor superfamily.

Clinical Relevance5

Disease Involvement

Cancer-related genes

Antibody (5)

HPA006404 CAB026150 CAB030007 CAB080525 CAB080526

Interaction Protein (3)

ENSG00000082512ENSG00000125735ENSG00000127191

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications9

PMID	Title	Abstract
24505114	Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform.	These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4.
31588238	Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment.	No abstract available
36635400	Proteomic profiling of urinary small extracellular vesicles in children with pneumonia: a pilot study.	No abstract available
36982312	Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis.	No abstract available
37922300	Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women.	No abstract available
38225453	Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available
40091455	Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss.	No abstract available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No abstract available