Protein detail
TNR14
Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)
Entry name TNR14 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 9 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)
Protein Class (5)
Cancer-related genesCD markersHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (5)
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
Transmembrane
203..223; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
ATARCD270HVEAHVEMLIGHTRTR2
Gene Description
TNF receptor superfamily member 14
Chromosome
1
Position
2555639-2565382
Supporting publications (n)
9
EVMP confidence score
0.63
Fluorescence & Localization5
Tissue SpecificretinaCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function (5)
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
Cellular Component (2)
Molecular Function (5)
Biological Process (3)
KEGG (4)
Reactome (6)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence74
Ligand-Receptor Signaling (68)
68 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| receptor | receptor | Baccin2019 | No | Yes | No | Yes | No |
| tumor_necrosis_factor | receptor | Almen2009 | No | Yes | No | Yes | No |
| tnf_receptor | receptor | CellPhoneDB | No | Yes | No | Yes | No |
| cytokine | receptor | Baccin2019 | No | Yes | No | Yes | No |
| tnf_ngf | receptor | HPMR | No | Yes | No | Yes | No |
| tnr4_tnf_ngf | receptor | HPMR | No | Yes | No | Yes | No |
| tnfngf | receptor | Surfaceome | No | Yes | No | Yes | No |
| checkpoint | receptor | ICELLNET | No | Yes | No | Yes | No |
| cytokine | receptor | ICELLNET | No | Yes | No | Yes | No |
Regulatory Interaction Network (2)
2 records.
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Lymphotoxin-alpha-TNFRSF14 receptor complex | LTATNFRSF14 | P01374Q92956 | 3:3 | ComplexPortal | 1861383714755292235244639462508 | |
| TNFSF14-TNFRSF14 receptor complex | TNFRSF14TNFSF14 | O43557Q92956 | 3:3 | ComplexPortalPDB | PDB:5T2QPDB:4RSUPDB:4FHQPDB:4rsuPDB:4EN0PDB:5T2RPDB:7msg | 186138372059228614755292371677623470935135604387 |
| TNFRSF14 | Q92956 | 2 | PDB | PDB:5t2qPDB:5t2r |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometryR Sequencing | 1 | 38343172 |
Sequence, Structure & Domains12
Sequences
Length
283
Mass
30,392
Sequence
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q92956-1; Sequence=Displayed; Name=2; IsoId=Q92956-2; Sequence=VSP_054186
Alternative Sequence
1..100; MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD -> MVSRPPRTPLSPSSWT (in isoform 2)
3D Structural Models
Helix
101..103
Beta Strand
46..49; 52..55; 61..65; 69..71; 74..77; 86..88; 105..109; 113..115; 118..121; 126..131; 134..139
3D Structure
X-ray crystallography (8)
Domain & Motif Annotations
Repeat
42..75; TNFR-Cys 1; 78..119; TNFR-Cys 2; 121..162; TNFR-Cys 3
Domain (CC)
The cysteine rich domain I (CRD1/TNFR-Cys 1) is required for interaction with BY55 and BTLA.
Protein Families
Tumor necrosis factor receptor superfamily
Sequence Similarities
Belongs to the tumor necrosis factor receptor superfamily.
Clinical Relevance5
Supporting Publications9
| PMID | Title | Abstract |
|---|---|---|
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 31588238 | Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment. | No abstract available |
| 36635400 | Proteomic profiling of urinary small extracellular vesicles in children with pneumonia: a pilot study. | No abstract available |
| 36982312 | Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis. | No abstract available |
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No abstract available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |