Protein detail
P2RX5
P2X purinoceptor 5 (P2X5) (ATP receptor) (Purinergic receptor)
Entry name P2RX5 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 2 | Protein classification Predicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
P2X purinoceptor 5 (P2X5) (ATP receptor) (Purinergic receptor)
Protein Class (3)
Predicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (2)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
Transmembrane
31..51; Helical; Name=1; 320..362; Helical; Name=2
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
LRH-1P2X5
Gene Description
Purinergic receptor P2X 5
Chromosome
17
Position
3672199-3696240
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Blood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function (2)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (7)
- GO:0001614 purinergic nucleotide receptor activity
- GO:0004888 transmembrane signaling receptor activity
- GO:0004931 extracellularly ATP-gated monoatomic cation channel activity
- GO:0005216 monoatomic ion channel activity
- GO:0005524 ATP binding
- GO:0035381 ATP-gated ion channel activity
- GO:0099095 ligand-gated monoatomic anion channel activity
Biological Process (3)
KEGG (3)
Reactome (4)
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence28
Ligand-Receptor Signaling (27)
27 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| ion_channel | ion_channel | DGIdb | No | Yes | No | No | No |
| ion_channel | ion_channel | Almen2009 | No | Yes | No | No | No |
| atp_gated | ion_channel | Almen2009 | No | Yes | No | No | No |
| ligand_gated | ion_channel | Almen2009 | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| ion_channel | ion_channel | OmniPath | No | Yes | No | No | No |
Page 1 of 3Next
Sequence, Structure & Domains9
Sequences
Length
444
Mass
49,303
Sequence
MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKAGKFSIIPTIINVGSGVALMGAGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=6; IsoId=Q93086-6; Sequence=Displayed; Name=1; IsoId=Q93086-3; Sequence=VSP_062294; Name=2; Synonyms=A; IsoId=Q93086-1; Sequence=VSP_062293, VSP_062294; Name=3; Synonyms=B; IsoId=Q93086-2; Sequence=VSP_062292, VSP_062293, VSP_062294; Name=4; IsoId=Q93086-4; Sequence=VSP_062294, VSP_062295; Name=5; IsoId=Q93086-5; Sequence=VSP_062292, VSP_062294
Alternative Sequence
97..120; Missing (in isoform 3 and isoform 5); 205..206; KS -> N (in isoform 3 and isoform 2); 328..349; Missing (in isoform 1, isoform 2, isoform 3, isoform 4 and isoform 5); 443..444; ST -> LRTPSASPLHQE (in isoform 4)
Domain & Motif Annotations
Domain (CC)
The second transmembrane domain and the conserved Asp-355 are essential for P2RX5 subunit assembly.
Region
378..444; Disordered
Protein Families
P2X receptor family
Sequence Similarities
Belongs to the P2X receptor family.
Clinical Relevance2
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 31414377 | Global extracellular vesicle proteomic signature defines U87-MG glioma cell hypoxic status with potential implications for non-invasive diagnostics. | No abstract available |