Protein detail
KISSR
KiSS-1 receptor (KiSS-1R) (G-protein coupled receptor 54) (G-protein coupled receptor OT7T175) (hOT7T175) (Hypogonadotropin-1) (Kisspeptins receptor) (Metastin receptor)
Entry name KISSR | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 7 | Protein classification Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
KiSS-1 receptor (KiSS-1R) (G-protein coupled receptor 54) (G-protein coupled receptor OT7T175) (hOT7T175) (Hypogonadotropin-1) (Kisspeptins receptor) (Metastin receptor)
Protein Class (6)
Disease related genesG-protein coupled receptorsHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
- Transporters
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- Potential drug targets
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
Transmembrane
47..67; Helical; Name=1; 79..101; Helical; Name=2; 121..138; Helical; Name=3; 158..178; Helical; Name=4; 203..223; Helical; Name=5; 264..284; Helical; Name=6; 306..328; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
AXOR12GPR54HOT7T175
Gene Description
KISS1 receptor
Chromosome
19
Position
917287-921005
Supporting publications (n)
2
EVMP confidence score
0.50
Function & Pathway7
Protein Function (5)
- Transporters
- Human disease related genes:Endocrine and metabolic diseases:Hypothalamus and pituitary gland diseases
- Potential drug targets
- G-protein coupled receptors:GPCRs excl olfactory receptors
- Disease related genes
Cellular Component (5)
Molecular Function (3)
Biological Process (3)
Reactome (5)
Mediation Categories (2)
Clinical-translation mediationReceptor-signaling mediation
Relations & Evidence62
Ligand-Receptor Signaling (57)
57 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| class_a_rhodopsin | receptor | GPCRdb | No | Yes | No | Yes | No |
| class_a_rhodopsin_peptide | receptor | GPCRdb | No | Yes | No | Yes | No |
| class_a_rhodopsin_peptide_kisspeptin | receptor | GPCRdb | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KISS1 | Q15726 | KISSR | Q969F8 | Yes | Yes | No | iTALKKEGG-MEDICUSGuide2Pharma_LRdbICELLNETSIGNORHPMR_talklrHPMRCellChatDBHPRD_LRdbtalklrscConnectHPRDRamilowski2015_Baccin2019Guide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrBaccin2019CellinkerSTRING_talklrGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | Baccin2019:11385580scConnect:11385580LRdb:12944565connectomeDB2020:11385580LRdb:11457843CellTalkDB:12944565connectomeDB2020:12944565connectomeDB2020:11457843Guide2Pharma:11457843Cellinker:12944565ICELLNET:12944565Baccin2019:12944565scConnect:11457843LRdb:11385580Baccin2019:15665093Cellinker:11457843connectomeDB2020:15665093Baccin2019:11457843Cellinker:11385580Guide2Pharma:11385580Cellinker:15665093LRdb:15665093HPMR:12944565HPRD:11457843SIGNOR:11385580 |
| KISSR | Q969F8 | GNA14 | O95837 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| KISSR | Q969F8 | GNAQ | P50148 | Yes | Yes | No | KEGG-MEDICUSSIGNOR | SIGNOR:31160049 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains10
Sequences
Length
398
Mass
42,586
Sequence
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
3D Structural Models
Turn
102..104; 324..326
Helix
40..44; 46..69; 71..73; 76..101; 112..145; 149..152; 156..174; 175..180; 198..212; 214..235; 246..287; 299..323; 328..335
Beta Strand
105..107; 181..184; 186..188; 190..193; 242..245; 292..294; 296..298
3D Structure
Electron microscopy (5); X-ray crystallography (1)
Domain & Motif Annotations
Region
341..363; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance8
Disease Involvement (2)
Disease variantHypogonadotropic hypogonadism
Related Diseases (2)
Biomarker
Terminated; Discontinued in Phase 1
Interaction Protein
ENSG00000113575
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 30875722 | Human Heart Explant-Derived Extracellular Vesicles: Characterization and Effects on the In Vitro Recellularization of Decellularized Heart Valves. | No abstract available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |