Protein detail

ESAM

Endothelial cell-selective adhesion molecule

Entry name ESAM	UniProt ID Q96AP7	EVMP confidence score 0.25
Supporting publications (n) 3	Transmembrane count 1	Protein classification Plasma proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information12

Protein Names

Endothelial cell-selective adhesion molecule

Protein Class (2)

Plasma proteinsPredicted membrane proteins

Transmembrane

249..269; Helical

Transmembrane Count

Ensembl

ENSG00000149564

Entrez Gene Symbol

ESAM

Gene Synonym

W117m

Gene Description

Endothelial cell adhesion molecule

Chromosome

Position

124752583-124762290

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization7

Tissue SpecificbrainCell SpecificTuft cellsSingle-Nuclei Brain SpecificastrocyteBlood Cell SpecificbasophilSecretome LocationIntracellular and membraneSecretome FunctionReceptor

Function & Pathway6

Cellular Component (5)

Molecular Function (2)

Biological Process (3)

KEGG (3)

Reactome (2)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence39

Ligand-Receptor Signaling (38)

38 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	CellChatDB	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	Baccin2019	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	CellPhoneDB	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	No	Yes	No
igcam_cxadr_like	cell_adhesion	HGNC	Yes	Yes	No	Yes	No
adhesion	adhesion	HGNC	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	HGNC	Yes	Yes	No	Yes	No

Page 1 of 4Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	ELISA	2	38113368 37322475

Sequence, Structure & Domains8

Sequences

Length

390

Mass

41,176

Sequence

MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96AP7-1; Sequence=Displayed; Name=2; IsoId=Q96AP7-2; Sequence=VSP_055594, VSP_055595, VSP_055596

Alternative Sequence

22..200; Missing (in isoform 2); 287..320; EDAIAPRTLPWPKSSDTISKNGTLSSVTSARALR -> VRSPLGLSFSAPKMEWLWKWRDAHFYRDSYLSKW (in isoform 2); 321..390; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

333..342; Polar residues

Domain (FT)

30..143; Ig-like V-type; 153..242; Ig-like C2-type

Region

316..368; Disordered

Clinical Relevance2

Disease Involvement (2)

Disease variantIntellectual disability

Antibody (2)

HPA056293 HPA072563

Supporting Publications3

PMID	Title	Abstract
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available
37670049	Proteomic and functional characterisation of extracellular vesicles from collagen VI deficient human fibroblasts reveals a role in cell motility.	No abstract available
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No abstract available