Protein detail
CKLF7
CKLF-like MARVEL transmembrane domain-containing protein 7 (Chemokine-like factor superfamily member 7)
Protein symbol CKLF7 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 4 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
CKLF-like MARVEL transmembrane domain-containing protein 7 (Chemokine-like factor superfamily member 7)
Protein Function
Transporters:Transporter channels and pores
Transmembrane
43..63; Helical; 77..97; Helical; 110..130; Helical; 140..160; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAdrenal medulla cellsSingle-Nuclei Brain SpecificLAMP5-LHX6 and Chandelier
Function & Pathway
Protein Function
Transporters:Transporter channels and pores
Cellular Component
Molecular Function
Biological Process
Canonical Pathways
- M31 Pid beta catenin deg pathway
- M90 Pid wnt canonical pathway
- M23 Pid wnt noncanonical pathway
Mediation Categories
Immune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| ligand | ligand | GO_Intercell | Yes | No | No | No | No |
| ligand | ligand | OmniPath | Yes | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains
Sequences
Length
175
Mass
18,834
Sequence
MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96FZ5-1; Sequence=Displayed; Name=2; IsoId=Q96FZ5-2; Sequence=VSP_042566
Alternative Sequence
112..144; Missing (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Domain (FT)
40..166; MARVEL
Protein Families
Chemokine-like factor family
Sequence Similarities
Belongs to the chemokine-like factor family.