Protein detail
CKLF7
CKLF-like MARVEL transmembrane domain-containing protein 7 (Chemokine-like factor superfamily member 7)
Entry name CKLF7 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 4 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
CKLF-like MARVEL transmembrane domain-containing protein 7 (Chemokine-like factor superfamily member 7)
Protein Function
Transporters:Transporter channels and pores
Transmembrane
43..63; Helical; 77..97; Helical; 110..130; Helical; 140..160; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue SpecificbrainCell SpecificAdrenal medulla cellsSingle-Nuclei Brain SpecificLAMP5-LHX6 and Chandelier
Function & Pathway6
Protein Function
Transporters:Transporter channels and pores
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Canonical Pathways (3)
- M31 Pid beta catenin deg pathway
- M90 Pid wnt canonical pathway
- M23 Pid wnt noncanonical pathway
Mediation Categories
Immune mediation
Relations & Evidence13
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellCellInteractions | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 2 of 2Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains8
Sequences
Length
175
Mass
18,834
Sequence
MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96FZ5-1; Sequence=Displayed; Name=2; IsoId=Q96FZ5-2; Sequence=VSP_042566
Alternative Sequence
112..144; Missing (in isoform 2)
Domain & Motif Annotations
Domain (FT)
40..166; MARVEL
Protein Families
Chemokine-like factor family
Sequence Similarities
Belongs to the chemokine-like factor family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |