Protein detail
S41A3
Solute carrier family 41 member 3
Entry name S41A3 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 10 | Protein classification Predicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Solute carrier family 41 member 3
Protein Class (2)
Predicted membrane proteinsTransporters
Protein Function
Transporters:Transporter channels and pores
Transmembrane
67..87; Helical; 152..172; Helical; 189..209; Helical; 220..240; Helical; 252..272; Helical; 284..304; Helical; 314..334; Helical; 377..397; Helical; 406..426; Helical; 482..502; Helical
Transmembrane Count
10
Ensembl
Entrez Gene Symbol
Gene Synonym
FLJ20473
Gene Description
Solute carrier family 41 member 3
Chromosome
3
Position
126006357-126101561
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization1
Cell SpecificNeutrophil progenitors
Function & Pathway5
Protein Function
Transporters:Transporter channels and pores
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence20
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC41A3 | MAPK8 | P45983 | S | 275 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (18)
18 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transporter | transporter | Surfaceome | No | Yes | No | No | No |
| solute_carrier | transporter | Almen2009 | No | Yes | No | No | No |
| slc41 | transporter | Surfaceome | No | Yes | No | No | No |
| slc | transporter | Surfaceome | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Mass spectrometry | 12 | 341862433976615836398564377869183481790628986585278941043064661638321535320897432914823933709510 |
Sequence, Structure & Domains9
Sequences
Length
507
Mass
54,767
Sequence
MDGTETRQRRLDSCGKPGELGLPHPLSTGGLPVASEDGALRAPESQSVTPKPLETEPSRETTWSIGLQVTVPFMFAGLGLSWAGMLLDYFQHWPVFVEVKDLLTLVPPLVGLKGNLEMTLASRLSTAANTGQIDDPQEQHRVISSNLALIQVQATVVGLLAAVAALLLGVVSREEVDVAKVELLCASSVLTAFLAAFALGVLMVCIVIGARKLGVNPDNIATPIAASLGDLITLSILALVSSFFYRHKDSRYLTPLVCLSFAALTPVWVLIAKQSPPIVKILKFGWFPIILAMVISSFGGLILSKTVSKQQYKGMAIFTPVICGVGGNLVAIQTSRISTYLHMWSAPGVLPLQMKKFWPNPCSTFCTSEINSMSARVLLLLVVPGHLIFFYIIYLVEGQSVINSQTFVVLYLLAGLIQVTILLYLAEVMVRLTWHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFICTQHLIVSLLSFYFPFCLLAKTSI
Alternative Products
Event=Alternative splicing; Named isoforms=9; Name=1; IsoId=Q96GZ6-1; Sequence=Displayed; Name=2; IsoId=Q96GZ6-2; Sequence=VSP_026938; Name=3; IsoId=Q96GZ6-3; Sequence=VSP_026935; Name=4; IsoId=Q96GZ6-4; Sequence=VSP_026935, VSP_026938; Name=5; IsoId=Q96GZ6-5; Sequence=VSP_026934, VSP_026937; Name=6; IsoId=Q96GZ6-6; Sequence=VSP_026936, VSP_026937; Name=7; IsoId=Q96GZ6-7; Sequence=VSP_035505, VSP_035506, VSP_026937; Name=8; IsoId=Q96GZ6-8; Sequence=VSP_043676, VSP_026937; Name=9; IsoId=Q96GZ6-9; Sequence=VSP_054059, VSP_054060
Alternative Sequence
1..117; Missing (in isoform 8); 1..26; Missing (in isoform 7); 27..90; STGGLPVASEDGALRAPESQSVTPKPLETEPSRETTWSIGLQVTVPFMFAGLGLSWAGMLLDYF -> MVVTQLNLEFCFQGKKLRGFSCELTRSPHGVLPESFFTIMCQVVVPILLSGLCMMTAGLVMNTI (in isoform 7); 61..69; Missing (in isoform 5); 92..127; Missing (in isoform 3 and isoform 4); 218..266; Missing (in isoform 6); 457..507; SSSVGHTAAVPRRCTASPGWGLIQPFICTQHLIVSLLSFYFPFCLLAKTSI -> TGLLALCFFTDWLLKSKAELGGISELASGPP (in isoform 5, isoform 6, isoform 7 and isoform 8); 457..487; SSSVGHTAAVPRRCTASPGWGLIQPFICTQH -> TGLLALCFFTDWLLKSKAELGGISELASGPP (in isoform 9); 488..507; Missing (in isoform 9); 501..507; Missing (in isoform 2 and isoform 4)
Domain & Motif Annotations
Compositional Bias
1..13; Basic and acidic residues
Region
1..60; Disordered
Protein Families
SLC41A transporter family
Sequence Similarities
Belongs to the SLC41A transporter family.
Clinical Relevance1
Antibody
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 37403840 | Phosphoproteome analysis of cerebrospinal fluid extracellular vesicles in primary central nervous system lymphoma. | No abstract available |
| 39996590 | Surface Double Dendritic Magnetic Microfibrils for Rapid Isolation and Proteomic Profiling of Extracellular Vesicles from Microliters of Biofluids. | No abstract available |