Protein detail

SIG10

Sialic acid-binding Ig-like lectin 10 (Siglec-10) (Siglec-like protein 2)

Protein symbol SIG10	UniProt ID Q96LC7	EVMP score 0.38
Frequency 1	Transmembrane count 1	Protein classification Predicted intracellular proteinsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Sialic acid-binding Ig-like lectin 10 (Siglec-10) (Siglec-like protein 2)

Protein Class

Predicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins

Transmembrane

551..571; Helical

Transmembrane Count

Ensembl

ENSG00000142512

Entrez Gene Symbol

SIGLEC10

Gene Synonym

MGC126774PRO940SIGLEC-10SLG2

Gene Description

Sialic acid binding Ig like lectin 10

Chromosome

Position

51410020-51417803

Frequency

EVMP Score

0.38

Fluorescence & Localization

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

KEGG

hsa04148 Efferocytosis

Reactome

Canonical Pathways

M31 Pid beta catenin deg pathway
M90 Pid wnt canonical pathway
M184 Pid ecadherin keratinocyte pathway

Mediation Categories

Immune mediation

Relations & Evidence

Enzyme-Mediated Modification

10 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
SIGLEC10	LCK	P06239	Y	691	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
SIGLEC10	LCK	P06239	Y	667	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:11733002 phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
SIGLEC10	LCK	P06239	Y	597	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:11733002 phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
SIGLEC10	JAK3	P52333	Y	691	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
SIGLEC10	JAK3	P52333	Y	667	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:11733002 phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
SIGLEC10	JAK3	P52333	Y	597	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:11733002 phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
SIGLEC10	ITK	Q08881	Y	667	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:11733002 phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
SIGLEC10	ITK	Q08881	Y	597	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:11733002 phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
SIGLEC10	ITK	Q08881	Y	691	phosphorylation	PhosphoNetworks
SIGLEC10	FYN	P06241	Y	667	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling

41 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	ICELLNET	No	Yes	Yes	Yes	No
receptor	receptor	CellTalkDB	No	Yes	Yes	Yes	No
receptor	receptor	LRdb	No	Yes	Yes	Yes	No
receptor	receptor	OmniPath	No	Yes	Yes	Yes	No
extracellular	extracellular	OmniPath	No	No	Yes	Yes	No
intracellular	intracellular	ComPPI	No	No	Yes	Yes	No
intracellular	intracellular	OmniPath	No	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	CellPhoneDB	Yes	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	Yes	Yes	No
ig_like	adhesion	Almen2009	Yes	Yes	Yes	Yes	No

Page 1 of 5Next

Regulatory Interaction Network

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ITK	Q08881	SIG10	Q96LC7	Yes	Yes	No	WangPhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:11733002 KEA:11733002 phosphoELM:11733002 PhosphoSite:12163025 ProtMapper:11733002
JAK3	P52333	SIG10	Q96LC7	Yes	Yes	No	WangphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper	SIGNOR:11733002 phosphoELM:11733002 KEA:11733002 ProtMapper:11733002
LCK	P06239	SIG10	Q96LC7	Yes	Yes	No	WangphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:11733002 phosphoELM:11733002 KEA:11733002 PhosphoSite:11733002 ProtMapper:11733002

Protein Complex Composition

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	SIGLEC10	Q96LC7	0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometryWestern blotting	3	38731868 30608700 40098346

Sequence, Structure & Domains

Sequences

Length

697

Mass

76,592

Sequence

MLLPLLLSSLLGGSQAMDGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRVERGSYVRYNFMNDGFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSWTGAALSSQGTKPTTSHFSVLSFTPRPQDHNTDLTCHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYLEAQKGQFLRLLCAADSQPPATLSWVLQNRVLSSSHPWGPRPLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLGNGTSLPVLEGQSLCLVCVTHSSPPARLSWTQRGQVLSPSQPSDPGVLELPRVQVEHEGEFTCHARHPLGSQHVSLSLSVHYSPKLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLGEELLEGNSSQDSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCEAWNVHGAQSGSILQLPDKKGLISTAFSNGAFLGIGITALLFLCLALIIMKILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKFQ

Alternative Products

Event=Alternative splicing; Named isoforms=9; Name=1; Synonyms=Long; IsoId=Q96LC7-1; Sequence=Displayed; Name=2; Synonyms=Short, Sv1; IsoId=Q96LC7-2; Sequence=VSP_002565; Name=3; Synonyms=Sv3; IsoId=Q96LC7-3; Sequence=VSP_002564; Name=4; Synonyms=Sv4; IsoId=Q96LC7-4; Sequence=VSP_002561; Name=5; Synonyms=Sv2; IsoId=Q96LC7-5; Sequence=VSP_002562, VSP_002563; Name=6; IsoId=Q96LC7-6; Sequence=VSP_002564, VSP_002565; Name=7; IsoId=Q96LC7-7; Sequence=VSP_045365, VSP_002565; Name=8; IsoId=Q96LC7-8; Sequence=VSP_002564, VSP_045853, VSP_045854, VSP_002565; Name=9; IsoId=Q96LC7-9; Sequence=VSP_045888, VSP_002565

Alternative Sequence

125..214; Missing (in isoform 4); 140..185; TALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSWTGAAL -> TGMRWGGNPCLSHWGGTLGTAYGLSREGSQGPLQHKNLPPRSLSQP (in isoform 5); 141..198; Missing (in isoform 3, isoform 6 and isoform 8); 141..188; Missing (in isoform 7); 146..228; Missing (in isoform 9); 186..697; Missing (in isoform 5); 252; A -> D (in isoform 8); 253..342; Missing (in isoform 8); 445..539; Missing (in isoform 2, isoform 6, isoform 7, isoform 8 and isoform 9)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

620..629; Pro residues; 650..659; Polar residues

Motif

595..600; ITIM motif 1; 665..670; ITIM motif 2

Domain (CC)

Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.

Domain (FT)

18..121; Ig-like V-type; 146..231; Ig-like C2-type 1; 251..339; Ig-like C2-type 2; 344..441; Ig-like C2-type 3

Region

606..697; Disordered

Protein Families

Immunoglobulin superfamily
SIGLEC (sialic acid binding Ig-like lectin) family

Sequence Similarities

Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.

Clinical Relevance

Drugs

CD24FC

Antibody

CAB025807 HPA027093